Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19648 Hoxa2 Mus musculus No

HuProt v2.0
Block Row Column Clone
32 23 29 JHU19648
32 23 30 JHU19648
HuProt v3.0
Block Row Column Clone
17 31 32 JHU19648
17 32 32 JHU19648
HuProt v3.1
Block Row Column Clone
17 31 32 JHU19648
17 32 32 JHU19648

External Database ID
  • Reviewed UniProt: P31245 (HXA2_MOUSE)

Nucleotide (1116bp)

>JHU19648
ATGAATTACGAATTTGAGCGAGAGATTGGTTTTATCAATAGCCAGCCGTCGCTCGCTGAGTGCCTGACATCTTTTCCCCC
TGTCGCTGATACATTTCAAAGTTCATCAATCAAGACCTCGACGCTTTCACACTCGACACTGATTCCTCCTCCTTTTGAGC
AGACCATTCCCAGCCTGAACCCGGGCAGTCACCCTCGCCACGGCGCTGGCGTTGGCGGCCGCCCCAAGTCGAGCCCCGCG
GGCAGTCGCGGCAGCCCGGTGCCTGCCGGCGCCCTGCAGCCGCCTGAGTATCCCTGGATGAAGGAGAAGAAGGCGGCCAA
GAAAACCGCGCTGCCGCCCGCCGCCGCCTCCACGGGCCCTGCCTGCCTCGGCCACAAAGAATCCCTGGAAATAGCTGATG
GCAGCGGCGGGGGATCCAGGCGTCTGAGAACCGCGTACACCAACACTCAGCTTTTGGAGCTGGAAAAGGAATTTCATTTC
AACAAGTACCTTTGCAGACCCCGCAGGGTGGAAATCGCCGCGCTGCTGGATTTGACCGAGAGACAAGTGAAAGTGTGGTT
TCAGAACCGGAGAATGAAGCATAAGAGGCAAACCCAGTGCAAGGAGAACCAAAACAGCGAAGGGAAATTTAAAAACCTGG
AGGACTCGGACAAAGTGGAGGAAGACGAGGAAGAGAAGTCACTCTTTGAGCAAGCCCTCAGTGTCTCCGGGGCCCTTCTG
GAGAGGGAAGGGTACACTTTTCAGCAAAATGCGCTCTCTCAACAGCAGGCTCCCAATGGACACAATGGCGACTCCCAAAC
TTTCCCAGTTTCGCCTTTAACCAGCAATGAGAAAAATTTGAAACATTTTCAGCACCAGTCACCCACTGTTCCTAACTGCT
TGTCAACAATGGGCCAGAACTGTGGAGCTGGCCTAAACAATGACAGTCCCGAGGCCATCGAGGTCCCCTCTTTGCAGGAC
TTCAATGTTTTCTCCACAGATTCCTGCCTGCAGCTTTCAGATGCACTGTCGCCCAGCTTGCCTGGCTCCCTGGACAGTCC
TGTAGATATCTCAGCTGACAGCTTTGACTTTTTTACAGACACACTCACCACAATCGACCTACAGCATCTGAATTAC

Protein (372aa)

>JHU19648
MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGVGGRPKSSPA
GSRGSPVPAGALQPPEYPWMKEKKAAKKTALPPAAASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHF
NKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALL
EREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQD
FNVFSTDSCLQLSDALSPSLPGSLDSPVDISADSFDFFTDTLTTIDLQHLNY