Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19642 HAND1 BHLHA27;EHAND Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (645bp)

>JHU19642
ATGAACCTCGTGGGCAGCTACGCACACCATCACCACCATCACCACCCGCACCCTGCGCACCCCATGCTCCACGAACCCTT
CCTCTTCGGTCCGGCCTCGCGCTGTCATCAGGAAAGGCCCTACTTCCAGAGCTGGCTGCTGAGCCCGGCTGACGCTGCCC
CGGACTTCCCTGCGGGCGGGCCGCCGCCCGCGGCCGCTGCAGCCGCCACCGCCTATGGTCCTGACGCCAGGCCTGGGCAG
AGCCCCGGGCGGCTGGAGGCGCTTGGCGGCCGTCTTGGCCGGCGGAAAGGCTCAGGACCCAAGAAGGAGCGGAGACGCAC
TGAGAGCATTAACAGCGCATTCGCGGAGTTGCGCGAGTGCATCCCCAACGTGCCGGCCGACACCAAGCTCTCCAAGATCA
AGACTCTGCGCCTAGCCACCAGCTACATCGCCTACCTGATGGACGTGCTGGCCAAGGATGCACAGTCTGGCGATCCCGAG
GCCTTCAAGGCTGAACTCAAGAAGGCGGATGGCGGCCGTGAGAGCAAGCGGAAAAGGGAGCTGCAGCAGCACGAAGGTTT
TCCTCCTGCCCTGGGCCCAGTCGAGAAGAGGATTAAAGGACGCACCGGCTGGCCGCAGCAAGTCTGGGCGCTGGAGTTAA
ACCAG

Protein (215aa)

>JHU19642
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQ
SPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPE
AFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ