Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19639 GSX2 GSH2 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (912bp)

>JHU19639
ATGTCGCGCTCCTTCTATGTCGACTCGCTCATCATCAAGGACACCTCACGGCCTGCGCCCTCGCTGCCTGAACCGCACCC
CGGGCCGGATTTCTTCATCCCGCTTGGCATGCCGCCCCCATTGGTGATGTCCGTGTCCGGCCCCGGCTGCCCGTCCCGCA
AGAGCGGCGCGTTCTGCGTGTGCCCTCTCTGCGTCACTTCGCACCTGCACTCCTCTCGGGGGTCTGTGGGCGCCGGCAGC
GGGGGCGCAGGGGCCGGGGTTACCGGGGCCGGAGGCAGTGGGGTGGCAGGGGCCGCAGGGGCACTGCCTCTGCTTAAGAG
CCAGTTCTCTTCGGCTCCTGGGGACGCGCAGTTTTGCCCGCGGGTGAACCATGCGCATCATCACCACCACCCGCCGCAGC
ACCACCATCACCATCATCAGCCCCAGCAGCCTGGCTCGGCCGCGGCGGCGGCAGCAGCAGCAGCGGCGGCGGCGGCCGCG
GCGGCCTTGGGGCACCCGCAGCACCACGCACCTGTCTGCACCGCCACCACCTACAACGTGGCGGACCCGCGGAGATTCCA
CTGCCTCACCATGGGAGGCTCTGACGCCAGCCAGGTACCCAATGGCAAGAGGATGAGGACGGCGTTCACTAGCACGCAAC
TCCTGGAGCTGGAGAGAGAATTCTCTTCCAACATGTACCTGTCTCGACTCCGGAGGATTGAAATCGCCACTTACCTGAAC
CTGTCGGAGAAGCAGGTGAAAATCTGGTTTCAGAACCGCCGAGTGAAGCACAAGAAGGAGGGGAAGGGCACGCAGAGGAA
CAGTCACGCGGGCTGCAAGTGCGTCGGGAGCCAGGTGCACTACGCGCGCTCCGAGGATGAGGACTCCCTGTCGCCGGCCT
CAGCCAACGATGACAAGGAGATTTCCCCCTTA

Protein (304aa)

>JHU19639
MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLHSSRGSVGAGS
GGAGAGVTGAGGSGVAGAAGALPLLKSQFSSAPGDAQFCPRVNHAHHHHHPPQHHHHHHQPQQPGSAAAAAAAAAAAAAA
AALGHPQHHAPVCTATTYNVADPRRFHCLTMGGSDASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLN
LSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVHYARSEDEDSLSPASANDDKEISPL