Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19635 FOXL1 FKHL11;FREAC7 Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
24 23 29 JHU19635
24 23 30 JHU19635
HuProt v3.0
Block Row Column Clone
17 31 22 JHU19635
17 32 22 JHU19635
HuProt v3.1
Block Row Column Clone
17 31 22 JHU19635
17 32 22 JHU19635

External Database ID

Nucleotide (1035bp)

>JHU19635
ATGAGTCACCTCTTCGATCCCCGGCTGCCTGCCCTGGCCGCCTCGCCCATGCTGTATCTGTACGGTCCCGAGAGACCCGG
CCTCCCTCTGGCCTTCGCCCCCGCGGCTGCTCTAGCTGCCTCGGGCCGGGCCGAGACCCCGCAGAAGCCTCCCTACAGCT
ACATCGCGCTCATCGCCATGGCGATCCAGGACGCGCCCGAGCAGAGGGTCACGCTCAACGGCATCTACCAGTTCATCATG
GACCGCTTCCCCTTCTACCACGACAACCGGCAGGGCTGGCAGAACAGCATCCGCCACAACCTCTCGCTCAACGACTGCTT
CGTCAAGGTGCCCCGCGAGAAAGGGCGGCCGGGCAAGGGCAGCTACTGGACGCTGGACCCCCGCTGCCTGGACATGTTTG
AGAACGGCAACTACCGGCGCCGGAAGAGGAAGCCCAAGCCGGGCCCCGGGGCCCCGGAGGCCAAGAGGCCCCGCGCCGAG
ACGCACCAGCGCAGCGCGGAGGCGCAGCCGGAGGCGGGGAGCGGGGCAGGGGGCTCGGGCCCCGCAATCTCCCGCCTGCA
GGCAGCGCCCGCGGGCCCCTCGCCCCTCCTGGACGGCCCCTCTCCGCCGGCGCCCCTCCACTGGCCGGGGACCGCGTCCC
CGAACGAGGACGCTGGTGACGCTGCCCAGGGCGCAGCGGCCGTGGCGGTCGGCCAGGCAGCGCGCACAGGGGACGGCCCG
GGGTCCCCTCTGCGCCCCGCCTCCCGCAGCTCTCCGAAGAGCTCCGACAAGTCCAAGAGCTTCAGCATAGACAGCATCCT
GGCGGGAAAGCAGGGCCAGAAGCCGCCTTCAGGGGACGAACTCCTAGGGGGTGCCAAGCCTGGGCCCGGCGGCCGTCTGG
GTGCCTCGCTCCTGGCCGCCTCCTCCAGCCTCCGTCCGCCTTTCAACGCTTCCCTGATGCTCGACCCGCATGTCCAGGGC
GGCTTTTACCAGCTCGGGATCCCCTTCCTCTCTTATTTCCCCCTGCAGGTTCCCGACACGGTACTCCACTTCCAG

Protein (345aa)

>JHU19635
MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIM
DRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAE
THQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
GSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQG
GFYQLGIPFLSYFPLQVPDTVLHFQ