Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19598 Sim1 Mus musculus No

HuProt v2.0
Block Row Column Clone
10 23 21 JHU19598
10 23 22 JHU19598
HuProt v3.0
Block Row Column Clone
19 31 15 JHU19598
19 32 15 JHU19598
HuProt v3.1
Block Row Column Clone
19 31 15 JHU19598
19 32 15 JHU19598

External Database ID
  • Reviewed UniProt: Q61045 (SIM1_MOUSE)

Nucleotide (2295bp)

>JHU19598
ATGAAAGAAAAGTCTAAAAATGCTGCCCGAACGAGGAGGGAGAAAGAAAACAGTGAATTTTATGAACTGGCTAAATTACT
GCCTTTACCCTCAGCCATCACCTCCCAACTGGACAAAGCATCCATCATCAGACTCACGACCAGCTATCTCAAAATGAGAG
TGGTCTTTCCAGAAGGGCTTGGCGAGGCGTGGGGCCACACCAGTCGAACCAGCCCCTTGGACAACGTTGGTCGCGAACTC
GGCTCTCATCTACTCCAGACTCTGGATGGCTTCATCTTCGTGGTGGCCCCAGATGGGAAGATCATGTACATTTCAGAGAC
AGCTTCAGTTCACCTGGGCCTTTCTCAGGTAGAGCTGACTGGGAACAGCATCTATGAATATATCCACCCGGCTGACCACG
ATGAGATGACAGCCGTGCTCACAGCCCATCAGCCCTACCACTCTCACTTTGTACAGGAGTACGAGATCGAACGCTCCTTC
TTTCTAAGGATGAAGTGTGTTTTGGCCAAGCGGAATGCTGGCCTCACCTGCGGTGGCTACAAGGTCATTCACTGTAGTGG
CTACCTGAAGATCCGCCAGTACAGCCTGGATATGTCTCCCTTTGATGGATGCTACCAAAATGTGGGCTTGGTGGCTGTGG
GTCACTCCCTGCCTCCGAGTGCTGTGACAGAGATCAAACTACACAGCAACATGTTCATGTTCCGAGCCAGTCTGGATATG
AAGCTTATTTTCCTGGACTCCAGGGTGGCAGAGCTGACTGGATATGAACCTCAGGACTTGATTGAGAAGACCCTGTACCA
TCACGTGCATGGCTGTGACACCTTCCACCTACGCTGTGCACACCACTTACTGTTGGTGAAGGGACAAGTGACCACCAAGT
ACTACAGGTTCTTGGCGAAGCAGGGCGGCTGGGTCTGGGTGCAGAGTTACGCCACCATCGTACACAACAGCCGCTCCTCC
AGGCCGCACTGCATCGTCAGCGTCAACTACGTCCTCACAGACACAGAATACAAAGGGCTACAGCTCTCCCTGGACCAGAT
ATCAGCCTCTAAGCCCACTTTCTCCTATACCAGCAGTTCCACTCCCACTATCTCGGACAACAGGAAGGGGGCCAAGTCAA
GGCTCTCCAGTAGCAAGTCAAAATCTAGGACCTCCCCATATCCCCAGTATTCGGGATTCCATACTGAGAGATCGGAATCT
GACCATGACAGCCAGTGGGGTGGAAGTCCCCTGACTGATACTGCCTCCCCACAGCTCCTGGACCCAGAGAGGCCTGGCTC
TCAGCACGAATTGTCCTGTGCGTATAGGCAGTTCCCAGATCGCAGTTCTCTCTGCTATGGTTTTGCTCTGGACCATTCCA
GGCTGGTGGAGGACAGGCACTTCCACACCCAAGCCTGCGAGGGAGGACGGTGCGAGGCAGGCAGGTACTTCCTGGGAGCA
CCACCTACTGGGAGAGATCCCTGGTGGGGCTCTCGAGCAGCTTTGCCTCTTACCAAGGCCTCCCCGGAGAGCAGAGAAGC
CTATGAGAACAGCATGCCTCATATCACCTCCATCCACAGAATCCACGGTCGAGGTCACTGGGATGAAGATAGTGTGGTCA
GCTCTCCAGACCCTGGGTCAGCCAGTGAATCTGGTGACCGATACCGCACCGAACAGTATCAAAATAGCCCACATGAACCT
AGCAAAATTGAAACTCTCATAAGAGCCACCCAGCAGATGATTAAAGAGGAAGAGAACAGATTACAGCTAAGGAAAGCCCC
TCCAGACCAACTGGCTTCCATTAATGGAGCTGGGAAAAAACACTCCCTCTGTTTTGCAAACTATCAACAGCCCCCACCCA
CAGGTGAGGTCTGCCACAGCTCTGCTCTTGCCAGCACTTCACCATGTGACCATATCCAGCAGAGAGAGGGAAAGATGCTC
AGCCCTCATGAAAATGACTATGACAACAGCCCCACTGCACTGTCTCGGATAAGTAGTCCTAGTTCTGATCGCATTACAAA
GTCTAGTTTAATCCTGGCTAAAGACTATCTACATTCAGATATGTCTCCCCATCAGACAGCAGGAGACCATCCTGCCATCT
CTCCAAACTGTTTTGGCTCCCACCGGCAGTATTTTGATAAGCATGCCTATACATTGACTGGTTATGCCCTGGAACACTTA
TATGACAGTGAGACTATTAGAAACTATTCCTTGGGCTGCAATGGCTCACACTTTGATGTGACTTCCCATCTAAGGATGCA
ACCAGACCCAGCACAAGGACACAAGGGAACATCTGTTATAATAACCAATGGAAGT

Protein (765aa)

>JHU19598
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGLGEAWGHTSRTSPLDNVGREL
GSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELTGNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSF
FLRMKCVLAKRNAGLTCGGYKVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAKQGGWVWVQSYATIVHNSRSS
RPHCIVSVNYVLTDTEYKGLQLSLDQISASKPTFSYTSSSTPTISDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSES
DHDSQWGGSPLTDTASPQLLDPERPGSQHELSCAYRQFPDRSSLCYGFALDHSRLVEDRHFHTQACEGGRCEAGRYFLGA
PPTGRDPWWGSRAALPLTKASPESREAYENSMPHITSIHRIHGRGHWDEDSVVSSPDPGSASESGDRYRTEQYQNSPHEP
SKIETLIRATQQMIKEEENRLQLRKAPPDQLASINGAGKKHSLCFANYQQPPPTGEVCHSSALASTSPCDHIQQREGKML
SPHENDYDNSPTALSRISSPSSDRITKSSLILAKDYLHSDMSPHQTAGDHPAISPNCFGSHRQYFDKHAYTLTGYALEHL
YDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS