Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19578 Foxg1 Mus musculus No

HuProt v2.0
Block Row Column Clone
2 23 17 JHU19578
2 23 18 JHU19578
HuProt v3.0
Block Row Column Clone
20 31 5 JHU19578
20 32 5 JHU19578
HuProt v3.1
Block Row Column Clone
20 31 5 JHU19578
20 32 5 JHU19578

External Database ID
  • Reviewed UniProt: Q60987 (FOXG1_MOUSE)

Nucleotide (1443bp)

>JHU19578
ATGCTGGACATGGGAGATAGGAAAGAGGTGAAAATGATTCCCAAGTCCTCGTTCAGCATCAACAGCCTGGTCCCCGAGGC
CGTCCAGAACGACAACCACCACGCGAGCCACGGCCACCACAACAGCCACCACCCCCAGCATCACCATCATCATCACCACC
ACCACCACCCGCCGCCGCCCGCGCCCCAGCCGCCTCCACCGCCGCCCCAGCAGCAGCAGCAGCAGCCGCCCCCGGCCCCG
CAGCCCCCGCAGGCGCGCGGCGCCCCAGCAGCCGACGACGACAAGGGTCCCCAGCCGCTCCTGCTCCCGCCCTCCACCGC
CCTGGACGGGGCCAAGGCTGACGCACTTGGAGCCAAAGGCGAGCCGGGCGGCGGGCCGGCGGAGCTGGCGCCCGTCGGGC
CGGACGAGAAGGAGAAGGGCGCGGGCGCCGGGGGGGAGGAGAAGAAAGGGGCGGGCGAGGGCGGCAAGGACGGGGAGGGG
GGCAAGGAGGGCGACAAGAAGAACGGCAAGTACGAGAAGCCGCCGTTCAGCTACAACGCGCTCATCATGATGGCCATCAG
GCAGAGTCCCGAGAAGCGCCTGACGCTCAATGGCATCTATGAGTTCATCATGAAGAACTTCCCCTACTACCGCGAGAACA
AGCAGGGCTGGCAGAACTCCATCCGCCACAACCTGTCCCTCAACAAGTGCTTCGTGAAGGTACCGCGCCACTACGACGAC
CCGGGCAAGGGCAACTACTGGATGCTCGACCCGTCGAGCGACGACGTGTTCATCGGCGGCACGACCGGCAAGCTGCGGCG
CCGCTCCACCACGTCTCGGGCCAAGCTGGCCTTTAAGCGCGGGGCGCGCCTCACCTCCACCGGCCTCACCTTCATGGACC
GCGCCGGCTCCCTCTACTGGCCCATGTCGCCCTTCCTGTCCCTGCACCACCCCCGCGCCAGCAGCACTTTGAGTTACAAC
GGGACCACGTCGGCCTACCCCAGCCACCCCATGCCCTACAGCTCCGTGTTGACTCAAAACTCGCTGGGCAACAACCACTC
CTTCTCCACCGCCAACGGGCTGAGTGTGGACCGGCTGGTCAACGGGGAGATCCCGTACGCCACGCACCACCTCACGGCCG
CTGCGCTCGCCGCCTCGGTGCCCTGCGGCCTGTCGGTGCCCTGCTCCGGGACCTACTCCCTCAACCCCTGCTCCGTCAAC
CTGCTCGCGGGCCAGACCAGTTACTTTTTCCCCCACGTCCCGCACCCGTCAATGACTTCGCAGACCAGCACGTCCATGAG
CGCCCGGGCCGCGTCCTCCTCTACGTCGCCGCAGGCCCCCTCGACCCTGCCCTGTGAGTCTTTAAGACCCTCTTTGCCAA
GTTTTACGACAGGACTGTCCGGGGGACTGTCTGATTATTTCACACATCAAAATCAGGGGTCTTCTTCCAACCCTTTAATA
CAT

Protein (481aa)

>JHU19578
MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAP
QPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEG
GKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDD
PGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYN
GTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVN
LLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLI
H