Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19558 PTPN20 PTPN20A;PTPN20B Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
7 26 13 JHU19558
7 26 14 JHU19558
8 27 29 JHU19558
8 27 30 JHU19558
14 27 29 JHU19558
14 27 30 JHU19558
HuProt v3.0
Block Row Column Clone
21 1 10 JHU19558
21 2 10 JHU19558
21 19 8 JHU19558
21 20 8 JHU19558
21 19 29 JHU19558
21 20 29 JHU19558
HuProt v3.1
Block Row Column Clone
21 1 10 JHU19558
21 2 10 JHU19558
21 19 8 JHU19558
21 20 8 JHU19558
21 19 29 JHU19558
21 20 29 JHU19558
23 51 8 JHU19558
23 52 8 JHU19558

External Database ID

Nucleotide (1263bp)

>JHU19558
ATGTCTTCACCTAGGGACTTTAGAGCAGAGCCTGTAAACGATTATGAGGGAAATGACTCTGAAGCAGAAGACTTGAATTT
CAGGGAGACTTTGCCTTCATCAAGTCAGGAAAACACACCTAGATCAAAGGTTTTTGAAAATAAAGTTAATTCAGAGAAGG
TAAAACTTTCTCTTCGGAATTTCCCACATAATGATTATGAGGATGTTTTTGAAGAGCCTTCAGAAAGTGGCAGTGATCCC
AGCATGTGGACAGCCAGAGGCCCCTTCAGAAGAGACAGGTGGAGCAGTGAGGATGAGGAGGCTGCAGGGCCATCACAGGC
TCTCTCCCCTCTACTTTCTGATACGCGCAAAATTGTTTCTGAAGGAGAACTAGATCAGTTGGCTCAGATTCGGCCATTAA
TATTCAATTTTCATGAGCAGACAGCCATCAAGGATTGTTTGAAAATCCTTGAGGAAAAAACAGCAGCGTATGATATCATG
CAGGAATTTATGGCTTTAGAACTTAAGAATCTGCCTGGTGAGTTCAACTCTGGGAATCAACCAAGCAACAGAGAAAAAAA
TAGATACCGAGATATTCTTCCATATGATTCAACACGCGTTCCTCTTGGAAAAAGCAAGGACTACATCAATGCTAGTTATA
TTAGAATAGTCAATTGTGGAGAAGAGTATTTTTATATCGCTACTCAAGGACCACTGCTGAGCACCATAGATGACTTTTGG
CAAATGGTGTTGGAAAATAATTCAAATGTTATTGCCATGATAACCAGAGAGATAGAAGGTGGAATTATCAAATGCTACCA
TTACTGGCCCATTTCTCTGAAGAAGCCATTGGAATTGAAACACTTCCGTGTATTCCTGGAGAACTACCAGATACTTCAAT
ATTTCATCATTCGAATGTTTCAAGTTGTGGAGAAGTCCACGGGAACTAGTCACTCTGTAAAACAGTTGCAGTTCACCAAG
TGGCCAGACCATGGCACTCCTGCCTCAGCAGATAGCTTCATAAAATATATTCGTTATGCAAGGAAGAGCCACCTTACAGG
ACCCATGGTTGTTCACTGCAGTGCCGGCATAGGCCGGACAGGGGTGTTCCTATGTGTGGATGTCGTGTTCTGTGCCATCG
TAAAGAACTGTTCATTCAACATCATGGATATAGTGGCCCAAATGAGAGAACAACGTTCTGGCATGGTTCAAACGAAGGAG
CAGTATCACTTTTGTTACGATATTGTGCTTGAAGTTCTTCGGAAACTTCTGACTTTGGATTAG

Protein (420aa)

>JHU19558
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGSDP
SMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIM
QEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTK
WPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKE
QYHFCYDIVLEVLRKLLTLD