Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19557 PPP1R12A MBS;MYPT1 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
15 26 13 JHU19557
15 26 14 JHU19557
16 27 25 JHU19557
16 27 26 JHU19557
14 27 25 JHU19557
14 27 26 JHU19557
HuProt v3.0
Block Row Column Clone
21 1 30 JHU19557
21 2 30 JHU19557
22 19 14 JHU19557
22 20 14 JHU19557
22 19 29 JHU19557
22 20 29 JHU19557
HuProt v3.1
Block Row Column Clone
21 1 30 JHU19557
21 2 30 JHU19557
22 19 14 JHU19557
22 20 14 JHU19557
22 19 29 JHU19557
22 20 29 JHU19557

External Database ID

Nucleotide (3093bp)

>JHU19557
ATGAAGATGGCGGACGCGAAGCAGAAGCGGAACGAGCAGCTGAAACGCTGGATCGGCTCCGAGACGGACCTCGAGCCTCC
GGTGGTGAAGCGCCAGAAGACCAAGGTGAAGTTCGACGATGGCGCCGTCTTCCTGGCTGCTTGCTCCAGCGGCGACACGG
ACGAGGTCCTCAAGCTGCTGCACCGCGGCGCCGACATCAATTACGCCAATGTGGACGGACTCACTGCCCTGCACCAGGCT
TGCATTGATGACAATGTTGATATGGTGAAGTTTCTGGTAGAAAATGGAGCAAATATTAATCAACCTGATAATGAAGGCTG
GATACCACTACATGCAGCAGCTTCCTGTGGATATCTTGATATTGCAGAGTTTTTGATTGGTCAAGGAGCACATGTAGGGG
CTGTCAACAGTGAAGGAGATACACCTTTAGATATTGCGGAGGAGGAGGCAATGGAAGAGCTACTTCAAAATGAAGTTAAT
CGGCAAGGGGTTGATATAGAAGCAGCTCGAAAGGAAGAAGAACGGATCATGCTTAGAGATGCCAGGCAGTGGCTAAATAG
TGGTCATATAAATGATGTCCGGCATGCAAAATCTGGAGGTACAGCACTTCACGTTGCAGCTGCTAAAGGCTATACGGAAG
TTTTAAAACTTTTAATACAGGCAGGCTATGATGTTAATATTAAAGACTATGATGGCTGGACACCTCTTCATGCTGCAGCT
CATTGGGGTAAAGAAGAAGCATGTCGAATTTTAGTGGACAATCTGTGTGATATGGAGATGGTCAACAAAGTGGGCCAAAC
AGCCTTTGATGTAGCAGATGAAGACATTTTAGGATATTTAGAAGAGTTGCAAAAGAAACAAAATCTGCTCCATAGTGAAA
AACGGGACAAGAAATCTCCACTAATTGAATCAACAGCAAATATGGACAATAATCAGTCACAGAAGACCTTTAAAAACAAA
GAGACGTTGATTATTGAACCAGAGAAAAATGCATCCCGTATTGAATCTCTGGAACAAGAAAAGGTTGATGAAGAAGAAGA
AGGAAAGAAGGATGAGTCTAGCTGCTCTAGTGAAGAAGATGAGGAAGATGACTCGGAATCAGAAGCTGAAACAGATAAGA
CAAAACCCCTGGCTTCTGTAACTAATGCCAACACTTCTAGTACACAAGCAGCTCCTGTAGCTGTTACAACACCTACTGTG
TCATCAGGTCAAGCAACACCTACATCACCTATTAAAAAGTTTCCAACCACAGCTACAAAAATTTCTCCCAAAGAAGAAGA
GAGAAAAGATGAGTCTCCTGCAACTTGGAGGTTAGGACTTAGAAAGACGGGCAGCTATGGTGCACTTGCTGAAATCACAG
CATCTAAAGAGGGTCAGAAAGAAAAAGATACTGCAGGTGTTACACGTTCAGCTTCAAGTCCCAGACTTTCCTCCTCTTTG
GATAATAAAGAAAAGGAGAAAGATAGTAAAGGAACTAGGCTTGCATATGTTGCACCTACAATACCAAGACGACTAGCCAG
TACATCTGACATTGAAGAGAAAGAAAACAGAGATTCTTCAAGTTTGCGAACAAGTAGTTCATATACAAGGAGAAAATGGG
AAGATGATCTTAAAAAAAATAGCTCAGTTAATGAAGGATCAACGTATCATAAAAGTTGCTCCTTTGGTAGAAGACAAGAT
GATTTGATTAGTTCTAGTGTTCCAAGCACCACATCAACACCAACAGTTACCTCTGCAGCTGGGCTTCAGAAAAGCCTGCT
TTCCAGCACAAGCACTACTACAAAGATTACAACGGGTTCTTCCTCAGCAGGCACACAAAGCAGTACCTCAAATCGTTTGT
GGGCTGAGGATAGTACTGAGAAAGAAAAGGACAGTGTTCCTACGGCAGTGACCATTCCTGTTGCTCCAACTGTTGTAAAT
GCTGCAGCTTCTACCACAACCCTGACTACAACTACTGCTGGCACTGTCTCCTCCACAACAGAGGTCAGGGAGAGACGCAG
ATCATACCTCACTCCTGTTAGGGATGAAGAGTCTGAATCCCAAAGAAAAGCAAGATCTAGACAAGCAAGACAATCTAGAA
GATCAACACAGGGAGTGACATTAACTGATCTTCAAGAAGCTGAGAAAACAATAGGAAGAAGTCGTTCTACCCGAACCAGA
GAACAAGAAAATGAAGAAAAAGAAAAAGAGGAAAAAGAGAAACAAGATAAAGAGAAACAAGAAGAAAAGAAGGAGTCAGA
AACATCTAGAGAAGATGAATATAAACAAAAGTACTCCAGAACGTATGATGAGACTTACCAGCGTTATAGGCCAGTATCAA
CTTCAAGTTCAACCACTCCATCCTCTTCACTTTCTACTATGAGCAGTTCACTGTATGCTTCAAGTCAACTAAACAGGCCA
AATAGTCTTGTAGGCATAACTTCTGCTTACTCCAGAGGAATAACAAAAGAAAATGAAAGAGAGGGAGAAAAAAGAGAAGA
GGAGAAAGAAGGAGAAGATAAATCACAACCTAAATCAATCAGAGAACGACGACGACCAAGAGAGAAAAGAAGATCTACAG
GAGTTTCATTTTGGACACAAGATAGTGATGAAAATGAACAAGAACAACAATCAGACACAGAAGAGGGATCCAATAAGAAA
GAAACTCAGACGGATTCCATTTCTAGATATGAAACCAGTTCTACATCAGCTGGTGATCGATATGATTCCTTGCTGGGTCG
CTCTGGATCATACAGTTACTTAGAAGAAAGAAAACCTTACAGCAGCAGGCTAGAAAAGGATGACTCAACTGACTTTAAAA
AGCTTTATGAACAAATTCTAGCTGAAAATGAAAAGCTGAAGGCACAGCTACATGATACAAATATGGAACTAACAGATCTT
AAATTACAGTTGGAAAAGGCCACCCAGAGACAAGAAAGATTTGCTGATAGATCACTGTTGGAAATGGAAAAAAGGGAACG
AAGAGCTCTAGAAAGAAGAATATCTGAAATGGAAGAAGAGCTCAAAATGTTACCAGACCTAAAAGCAGACAACCAGAGGC
TAAAGGATGAAAATGGGGCCTTGATCAGAGTTATAAGCAAACTTTCCAAATAG

Protein (1030aa)

>JHU19557
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQA
CIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVN
RQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNK
ETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTV
SSGQATPTSPIKKFPTTATKISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQD
DLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVN
AAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTPSSSLSTMSSSLYASSQLNRP
NSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSIRERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKK
ETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK