Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU19553 MASTL GW;GWL;THC2 Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
31 26 13 JHU19553
31 26 14 JHU19553
48 27 23 JHU19553
48 27 24 JHU19553
30 27 25 JHU19553
30 27 26 JHU19553
32 27 29 JHU19553
32 27 30 JHU19553
HuProt v3.0
Block Row Column Clone
21 1 28 JHU19553
21 2 28 JHU19553
23 23 32 JHU19553
23 24 32 JHU19553
22 19 27 JHU19553
22 20 27 JHU19553
21 19 32 JHU19553
21 20 32 JHU19553
HuProt v3.1
Block Row Column Clone
21 1 28 JHU19553
21 2 28 JHU19553
23 23 32 JHU19553
23 24 32 JHU19553
22 19 27 JHU19553
22 20 27 JHU19553
21 19 32 JHU19553
21 20 32 JHU19553

External Database ID

Nucleotide (2637bp)

>JHU19553
ATGGATCCCACCGCGGGAAGCAAGAAGGAGCCTGGAGGAGGCGCGGCGACTGAGGAGGGCGTGAATAGGATCGCAGTGCC
AAAACCGCCCTCCATTGAGGAATTCAGCATAGTGAAGCCCATTAGCCGGGGCGCCTTCGGGAAAGTGTATCTGGGGCAGA
AAGGCGGCAAATTGTATGCAGTAAAGGTTGTTAAAAAAGCAGACATGATCAACAAAAATATGACTCATCAGGTCCAAGCT
GAGAGAGATGCACTGGCACTAAGCAAAAGCCCATTCATTGTCCATTTGTATTATTCACTGCAGTCTGCAAACAATGTCTA
CTTGGTAATGGAATATCTTATTGGGGGAGATGTCAAGTCTCTCCTACATATATATGGTTATTTTGATGAAGAGATGGCTG
TGAAATATATTTCTGAAGTAGCACTGGCTCTAGACTACCTTCACAGACATGGAATCATCCACAGGGACTTGAAACCGGAC
AATATGCTTATTTCTAATGAGGGTCATATTAAACTGACGGATTTTGGCCTTTCAAAAGTTACTTTGAATAGAGATATTAA
TATGATGGATATCCTTACAACACCATCAATGGCAAAACCTAGACAAGATTATTCAAGAACCCCAGGACAAGTGTTATCGC
TTATCAGCTCGTTGGGATTTAACACACCAATTGCAGAAAAAAATCAAGACCCTGCAAACATCCTTTCAGCCTGTCTGTCT
GAAACATCACAGCTTTCTCAAGGACTCGTATGCCCTATGTCTGTAGATCAAAAGGACACTACGCCTTATTCTAGCAAATT
ACTAAAATCATGTCTTGAAACAGTTGCCTCCAACCCAGGAATGCCTGTGAAGTGTCTAACTTCTAATTTACTCCAGTCTA
GGAAAAGGCTGGCCACATCCAGTGCCAGTAGTCAATCCCACACCTTCATATCCAGTGTGGAATCAGAATGCCACAGCAGT
CCCAAATGGGAAAAAGATTGCCAGGAAAGTGATGAAGCATTGGGCCCAACAATGATGAGTTGGAATGCAGTTGAAAAGTT
ATGCGCAAAATCTGCAAATGCCATTGAGACGAAAGGTTTCAATAAAAAGGATCTGGAGTTAGCTCTTTCTCCCATTCATA
ACAGCAGTGCCCTTCCCACCACTGGACGCTCTTGTGTAAACCTTGCTAAAAAATGCTTCTCTGGGGAAGTTTCTTGGGAA
GCAGTAGAACTGGATGTAAATAATATAAATATGGACACTGACACAAGTCAGTTAGGTTTCCATCAGTCAAATCAGTGGGC
TGTGGATTCTGGTGGGATATCTGAAGAGCACCTTGGGAAAAGAAGTTTAAAAAGAAATTTTGAGTTGGTTGACTCCAGTC
CTTGTAAAAAAATTATACAGAATAAAAAAACTTGTGTAGAGTATAAGCATAACGAAATGACAAATTGTTATACAAATCAA
AATACAGGCTTAACAGTTGAAGTGCAGGACCTTAAGCTATCAGTGCACAAAAGTCAACAAAATGACTGTGCTAATAAGGA
GAACATTGTCAATTCTTTTACTGATAAACAACAAACACCAGAAAAATTACCTATACCAATGATAGCAAAAAACCTTATGT
GTGAACTCGATGAAGACTGTGAAAAGAATAGTAAGAGGGACTACTTAAGTTCTAGTTTTCTATGTTCTGATGATGATAGA
GCTTCTAAAAATATTTCTATGAACTCTGATTCATCTTTTCCTGGAATTTCTATAATGGAAAGTCCATTAGAAAGTCAGCC
CTTAGATTCAGATAGAAGCATCAAAGAATCCTCTTTTGAAGAATCAAATATTGAAGATCCACTTATTGTAACACCAGATT
GCCAAGAAAAGACCTCACCAAAAGGTGTCGAGAACCCTGCTGTACAAGAGAGTAACCAAAAAATGTTAGGTCCTCCTTTG
GAGGTGCTGAAAACGTTAGCCTCTAAAAGAAATGCTGTTGCTTTTCGAAGTTTTAACAGTCATATTAATGCATCCAATAA
CTCAGAACCATCCAGAATGAACATGACTTCTTTAGATGCAATGGATATTTCGTGTGCCTACAGTGGTTCATATCCCATGG
CTATAACCCCTACTCAAAAAAGAAGATCCTGTATGCCACATCAGACCCCAAATCAGATCAAGTCGGGAACTCCATACCGA
ACTCCGAAGAGTGTGAGAAGAGGGGTGGCCCCCGTTGATGATGGGCGAATTCTAGGAACCCCAGACTACCTTGCACCTGA
GCTGTTACTAGGCAGGGCCCATGGTCCTGCGGTAGACTGGTGGGCACTTGGAGTTTGCTTGTTTGAATTTCTAACAGGAA
TTCCCCCTTTCAATGATGAAACACCACAACAAGTATTCCAGAATATTCTGAAAAGAGATATCCCTTGGCCAGAAGGTGAA
GAAAAGTTATCTGATAATGCTCAAAGTGCAGTAGAAATACTTTTAACCATTGATGATACAAAGAGAGCTGGAATGAAAGA
GCTAAAACGTCATCCTCTCTTCAGTGATGTGGACTGGGAAAATCTGCAGCATCAGACTATGCCTTTCATCCCCCAGCCAG
ATGATGAAACAGATACCTCCTATTTTGAAGCCAGGAATACTGCTCAGCACCTGACTGTATCTGGATTTAGTCTGTAG

Protein (878aa)

>JHU19553
MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYAVKVVKKADMINKNMTHQVQA
ERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPD
NMLISNEGHIKLTDFGLSKVTLNRDINMMDILTTPSMAKPRQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLS
ETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATSSASSQSHTFISSVESECHSS
PKWEKDCQESDEALGPTMMSWNAVEKLCAKSANAIETKGFNKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWE
AVELDVNNINMDTDTSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQ
NTGLTVEVQDLKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFLCSDDDR
ASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFEESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPL
EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSGTPYR
TPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFNDETPQQVFQNILKRDIPWPEGE
EKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDWENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL