Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00022 COL4A3BP CERT;STARD11 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
28 1 13 JHU00022
28 1 14 JHU00022
HuProt v3.0
Block Row Column Clone
1 1 26 JHU00022
1 2 26 JHU00022
HuProt v3.1
Block Row Column Clone
1 1 26 JHU00022
1 2 26 JHU00022

External Database ID

Nucleotide (1797bp)

>JHU00022
ATGTCGGATAATCAGAGCTGGAACTCGTCGGGCTCGGAGGAGGATCCAGAGACGGAGTCTGGGCCGCCTGTGGAGCGCTG
CGGGGTCCTCAGTAAGTGGACAAACTACATTCATGGGTGGCAGGATCGTTGGGTAGTTTTGAAAAATAATGCTCTGAGTT
ACTACAAATCTGAAGATGAAACAGAGTATGGCTGCAGAGGATCCATCTGTCTTAGCAAGGCTGTCATCACACCTCACGAT
TTTGATGAATGTCGATTTGATATTAGTGTAAATGATAGTGTTTGGTATCTTCGTGCTCAGGATCCAGATCATAGACAGCA
ATGGATAGATGCCATTGAACAGCACAAGACTGAATCTGGATATGGATCTGAATCCAGCTTGCGTCGACATGGCTCAATGG
TGTCCCTGGTGTCTGGAGCAAGTGGCTACTCTGCAACATCCACCTCTTCATTCAAGAAAGGCCACAGTTTACGTGAGAAG
TTGGCTGAAATGGAAACATTTAGAGACATCTTATGTAGACAAGTTGACACGCTACAGAAGTACTTTGATGCCTGTGCTGA
TGCTGTCTCTAAGGATGAACTTCAAAGGGATAAAGTGGTAGAAGATGATGAAGATGACTTTCCTACAACGCGTTCTGATG
GTGACTTCTTGCATAGTACCAACGGCAATAAAGAAAAGTTATTTCCACATGTGACACCAAAAGGAATTAATGGTATAGAC
TTTAAAGGGGAAGCGATAACTTTTAAAGCAACTACTGCTGGAATCCTTGCAACACTTTCTCATTGTATTGAACTAATGGT
TAAACGTGAGGACAGCTGGCAGAAGAGACTGGATAAGGAAACTGAGAAGAAAAGAAGAACAGAGGAAGCATATAAAAATG
CAATGACAGAACTTAAGAAAAAATCCCACTTTGGAGGACCAGATTATGAAGAAGGCCCTAACAGTCTGATTAATGAAGAA
GAGTTCTTTGATGCTGTTGAAGCTGCTCTTGACAGACAAGATAAAATAGAAGAACAGTCACAGAGTGAAAAGGTGAGATT
ACATTGGCCTACATCCTTGCCCTCTGGAGATGCCTTTTCTTCTGTGGGGACACATAGATTTGTCCAAAAGGTTGAAGAGA
TGGTGCAGAACCACATGACTTACTCATTACAGGATGTAGGCGGAGATGCCAATTGGCAGTTGGTTGTAGAAGAAGGAGAA
ATGAAGGTATACAGAAGAGAAGTAGAAGAAAATGGGATTGTTCTGGATCCTTTAAAAGCTACCCATGCAGTTAAAGGCGT
CACAGGACATGAAGTCTGCAATTATTTCTGGAATGTTGACGTTCGCAATGACTGGGAAACAACTATAGAAAACTTTCATG
TGGTGGAAACATTAGCTGATAATGCAATCATCATTTATCAAACACACAAGAGGGTGTGGCCTGCTTCTCAGCGAGACGTA
TTATATCTTTCTGTCATTCGAAAGATACCAGCCTTGACTGAAAATGACCCTGAAACTTGGATAGTTTGTAATTTTTCTGT
GGATCATGACAGTGCTCCTCTAAACAACCGATGTGTCCGTGCCAAAATAAATGTTGCTATGATTTGTCAAACCTTGGTAA
GCCCACCAGAGGGAAACCAGGAAATTAGCAGGGACAACATTCTATGCAAGATTACATATGTAGCTAATGTGAACCCTGGA
GGATGGGCACCAGCCTCAGTGTTAAGGGCAGTGGCAAAGCGAGAGTATCCTAAATTTCTAAAACGTTTTACTTCTTACGT
CCAAGAAAAAACTGCAGGAAAGCCTATTTTGTTCTAG

Protein (598aa)

>JHU00022
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHD
FDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREK
LAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEE
EFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGE
MKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDV
LYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPG
GWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF