Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU18831 BUB1B BUBR1;MAD3L;SSK1 Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
30 1 9 JHU18831
30 1 10 JHU18831
2 29 1 JHU18831
2 29 2 JHU18831
HuProt v3.0
Block Row Column Clone
2 1 27 JHU18831
2 2 27 JHU18831
24 37 5 JHU18831
24 38 5 JHU18831
HuProt v3.1
Block Row Column Clone
2 1 27 JHU18831
2 2 27 JHU18831
24 37 5 JHU18831
24 38 5 JHU18831

External Database ID

Nucleotide (3153bp)

>JHU18831
ATGGCGGCGGTGAAGAAGGAAGGGGGTGCTCTGAGTGAAGCCATGTCCCTGGAGGGAGATGAATGGGAACTGAGTAAAGA
AAATGTACAACCTTTAAGGCAAGGGCGGATCATGTCCACGCTTCAGGGAGCACTGGCACAAGAATCTGCCTGTAACAATA
CTCTTCAGCAGCAGAAACGGGCATTTGAATATGAAATTCGATTTTACACTGGAAATGACCCTCTGGATGTTTGGGATAGG
TATATCAGCTGGACAGAGCAGAACTATCCTCAAGGTGGGAAGGAGAGTAATATGTCAACGTTATTAGAAAGAGCTGTAGA
AGCACTACAAGGAGAAAAACGATATTATAGTGATCCTCGATTTCTCAATCTCTGGCTTAAATTAGGGCGTTTATGCAATG
AGCCTTTGGATATGTACAGTTACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAA
GAATATGAAGCTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGA
AAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAAGAAGAAGAGG
AGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAGGGAAAAAGACAGCAAGAGCT
CCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGGACTCCAAAATCCATTTCCTCAACAGATGCA
AAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGATGAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGC
CATGGATAGCACCCCCCATGCCCAGGGCCAAAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAA
CACAGGCCTCGTGGCAATACAGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGAC
TGCACAACAGCCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGG
AAGAAGGAGATTCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGATGTATTGTAAG
GAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTCCGGAAGAAATTAAAAGAGCA
AAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGAAACAGATTGAAGAGATGGAGAAGAAGCTAA
AAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCAGCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTG
CAAATTGCTTCCGAGTCTCAGAAAATACCAGGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGA
AACTTCACTTGCGGAGAACATTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGT
TTCTTCTTTCAGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAATTGAACCCTT
GAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGACACTTGTGACTTTGCCAGAG
CAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGATCTCCCTTCTGATCCTGAGAGACTGTTACCG
GAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGACAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAA
GAAGCTGAGCCCAATTATTGAAGACAGTCGTGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAA
GCACCTCCTCCATCAAATGTCTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCA
CCATGGTGTTCACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGA
CAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGAGAATACCTAA
TATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAATAAAGGTATCTTCTCAACCT
GTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCA
ATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATA
TTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCAT
GGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTT
GAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTAC
AGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCA
CATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCT
AAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGG
AGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAG
TTAACTAGTCCTGGGGCTTTGCTCTTTCAGTAG

Protein (1050aa)

>JHU18831
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR
YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAE
EYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA
PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLE
HRPRGNTASLIAVPAVLPSFTPYVEETAQQPVMTPCKIEPSINHILSTRKPGKEEGDSLQRVQSHQQASEEKKEKMMYCK
EKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL
QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLP
EEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS
PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQP
VPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVH
GDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA
HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGK
LTSPGALLFQ