Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU18747 CAPN12 Homo sapiens No

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone

External Database ID

Nucleotide (2157bp)

>JHU18747
ATGGCATCCAGCAGTGGGAGGGTCACCATCCAGCTCGTGGATGAGGAGGCTGGGGTCGGAGCCGGGCGCCTGCAGCTTTT
TCGGGGCCAGAGCTATGAGGCAATTCGGGCAGCCTGCCTGGATTCGGGGATCCTGTTCCGCGACCCTTACTTCCCTGCTG
GCCCTGATGCCCTTGGCTATGACCAGCTGGGGCCGGACTCGGAGAAGGCCAAAGGCGTGAAATGGATGAGGCCCCATGAG
TTCTGTGCTGAGCCGAAGTTCATCTGTGAAGACATGAGCCGCACAGACGTGTGTCAGGGGAGCCTGGGTAACTGCTGGTT
CCTTGCAGCCGCCGCCTCCCTTACTCTGTATCCCCGGCTCCTGCGCCGGGTGGTCCCTCCTGGACAGGATTTCCAGCATG
GCTACGCAGGCGTCTTCCACTTCCAGCTCTGGCAGTTTGGCCGCTGGATGGACGTCGTGGTGGATGACAGGCTGCCCGTG
CGTGAGGGGAAGCTGATGTTCGTGCGCTCGGAACAGCGGAATGAGTTCTGGGCCCCACTCCTGGAGAAGGCCTACGCCAA
GCTCCACGGCTCCTATGAGGTGATGCGGGGCGGCCACATGAATGAGGCTTTTGTGGATTTCACAGGCGGCGTGGGCGAGG
TGCTCTATCTGAGACAAAACAGCATGGGGCTGTTCTCTGCCCTGCGCCATGCCCTGGCCAAGGAGTCCCTCGTGGGCGCC
ACTGCCCTGAGTGATCGGGGTGAGTACCGCACAGAAGAGGGCCTGGTAAAGGGACACGCGTATTCCATCACGGGCACACA
CAAGGTGTTCCTGGGCTTCACCAAGGTGCGGCTGCTGCGGCTGCGGAACCCATGGGGCTGCGTGGAGTGGACGGGGGCCT
GGAGCGACAGCTGCCCACGCTGGGACACACTCCCCACCGAGTGCCGCGATGCCCTGCTGGTGAAAAAGGAGGATGGCGAG
TTCTGGATGGAGCTGCGGGACTTCCTCCTCCATTTCGACACCGTGCAGATCTGCTCGCTGAGCCCGGAGGTGCTGGGCCC
CAGCCCGGAGGGGGGCGGCTGGCACGTCCACACCTTCCAAGGCCGCTGGGTGCGTGGCTTCAACTCCGGCGGGAGCCAGC
CTAATGCTGAAACCTTCTGGACCAATCCTCAGTTCCGTTTAACGCTGCTGGAGCCTGATGAGGAGGATGACGAGGATGAG
GAAGGGCCCTGGGGGGGCTGGGGGGCTGCAGGGGCACGGGGCCCAGCGCGGGGGGGCCGCACGCCCAAGTGCACGGTCCT
TCTGTCCCTCATCCAGCGCAACCGGCGGCGCCTGAGAGCCAAGGGCCTCACTTACCTCACCGTTGGCTTCCACGTGTTCC
AGATTCCAGAGGAGCTGCTGGGCCTCTGGGATTCCCCGCGCAGCCATGCGCTCCTGCCCCGGCTGCTGCGCGCCGACCGC
TCGCCCCTCAGCGCCCGCCGCGACGTGACCCGCCGCTGCTGCCTGCGTCCAGGCCACTACCTGGTGGTGCCGAGCACCGC
CCACGCCGGCGACGAGGCTGACTTCACTCTGCGTGTCTTCTCCGAGCGCCGCCACACGGCCGTGGAGATCGACGACGTGA
TCAGCGCAGACCTGCAGTCTCTCCAGGGCCCCTACCTGCCCCTGGAGCTGGGGTTGGAGCAGCTGTTTCAGGAGCTGGCT
GGAGAGGAGGAAGAACTCAATGCCTCTCAGCTCCAGGCCTTACTAAGCATTGCCCTGGAGCCTGCCAGGGCCCATACCTC
CACCCCCAGAGAGATCGGGCTCAGGACCTGTGAGCAGCTGCTGCAGTGTTTCGGGCATGGGCAAAGCCTGGCCTTACACC
ACTTCCAGCAGCTCTGGGGCTACCTCCTGGAGTGGCAGGCCATATTTAACAAGTTCGATGAGGACACCTCTGGAACCATG
AACTCCTACGAGCTGAGGCTGGCACTGAATGCAGCAGGCTTCCACCTGAACAACCAGCTGACCCAGACCCTCACCAGCCG
CTACCGGGATAGCCGTCTGCGTGTGGACTTCGAGCGGTTCGTGTCCTGTGTGGCCCACCTCACCTGCATCTTCTGCCACT
GCAGCCAGCACCTGGATGGGGGTGAGGGGGTCATCTGCCTGACCCACAGACAGTGGATGGAGGTGGCCACCTTCTCC

Protein (719aa)

>JHU18747
MASSSGRVTIQLVDEEAGVGAGRLQLFRGQSYEAIRAACLDSGILFRDPYFPAGPDALGYDQLGPDSEKAKGVKWMRPHE
FCAEPKFICEDMSRTDVCQGSLGNCWFLAAAASLTLYPRLLRRVVPPGQDFQHGYAGVFHFQLWQFGRWMDVVVDDRLPV
REGKLMFVRSEQRNEFWAPLLEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNSMGLFSALRHALAKESLVGA
TALSDRGEYRTEEGLVKGHAYSITGTHKVFLGFTKVRLLRLRNPWGCVEWTGAWSDSCPRWDTLPTECRDALLVKKEDGE
FWMELRDFLLHFDTVQICSLSPEVLGPSPEGGGWHVHTFQGRWVRGFNSGGSQPNAETFWTNPQFRLTLLEPDEEDDEDE
EGPWGGWGAAGARGPARGGRTPKCTVLLSLIQRNRRRLRAKGLTYLTVGFHVFQIPEELLGLWDSPRSHALLPRLLRADR
SPLSARRDVTRRCCLRPGHYLVVPSTAHAGDEADFTLRVFSERRHTAVEIDDVISADLQSLQGPYLPLELGLEQLFQELA
GEEEELNASQLQALLSIALEPARAHTSTPREIGLRTCEQLLQCFGHGQSLALHHFQQLWGYLLEWQAIFNKFDEDTSGTM
NSYELRLALNAAGFHLNNQLTQTLTSRYRDSRLRVDFERFVSCVAHLTCIFCHCSQHLDGGEGVICLTHRQWMEVATFS