Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00211 DIRAS3 ARHI;NOEY2;RHOI Homo sapiens Yes Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
9 1 9 JHU00211
9 1 10 JHU00211
HuProt v3.0
Block Row Column Clone
2 1 11 JHU00211
2 2 11 JHU00211
HuProt v3.1
Block Row Column Clone
2 1 11 JHU00211
2 2 11 JHU00211

External Database ID

Nucleotide (690bp)

>JHU00211
ATGGGTAACGCCAGCTTTGGCTCCAAGGAACAGAAGCTGCTGAAGCGGTTGCGGCTTCTGCCCGCCCTGCTTATCCTCCG
CGCCTTCAAGCCCCACAGGAAGATCAGAGATTACCGCGTCGTGGTAGTCGGCACCGCTGGTGTGGGGAAAAGTACGCTGC
TGCACAAGTGGGCGAGCGGCAACTTCCGTCATGAGTACCTGCCGACCATTGAAAATACCTACTGCCAGTTGCTGGGCTGC
AGCCACGGTGTGCTTTCCCTGCACATCACCGACAGCAAGAGTGGCGACGGCAACCGCGCTCTGCAGCGCCACGTTATAGC
CCGGGGCCACGCCTTCGTCCTGGTCTACTCAGTCACCAAGAAGGAAACCCTGGAAGAGCTGAAGGCCTTCTATGAGCTGA
TCTGCAAGATCAAAGGTAACAACCTGCATAAGTTCCCCATCGTGCTGGTGGGCAATAAAAGTGATGACACCCACCGGGAG
GTGGCCCTGAATGATGGTGCCACCTGTGCGATGGAGTGGAATTGCGCCTTCATGGAGATTTCAGCCAAGACCGATGTGAA
TGTGCAGGAGCTGTTCCACATGCTGCTGAATTACAAGAAAAAGCCCACCACCGGCCTCCAGGAGCCCGAGAAGAAATCCC
AGATGCCCAACACCACTGAGAAGCTGCTTGACAAGTGCATAATCATGTAG

Protein (229aa)

>JHU00211
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGC
SHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHRE
VALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM