Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00021 CLK3 Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
42 1 13 JHU00021
42 1 14 JHU00021
37 24 27 JHU00021
37 24 28 JHU00021
HuProt v3.0
Block Row Column Clone
1 3 15 JHU00021
1 4 15 JHU00021
18 47 21 JHU00021
18 48 21 JHU00021
HuProt v3.1
Block Row Column Clone
1 3 15 JHU00021
1 4 15 JHU00021
18 47 21 JHU00021
18 48 21 JHU00021

External Database ID
  • Reviewed UniProt: P49761-3 (CLK3_HUMAN)

Nucleotide (1404bp)

>JHU00021
ATGCATCACTGTAAGCGATACCGCTCCCCTGAACCAGACCCGTACCTGAGCTACCGATGGAAGAGGAGGAGGTCCTACAG
TCGGGAACATGAAGGGAGACTGCGATACCCGTCCCGAAGGGAGCCTCCCCCACGAAGATCTCGGTCCAGAAGCCATGACC
GCCTGCCCTACCAGAGGAGGTACCGGGAGCGCCGTGACAGCGATACATACCGGTGTGAAGAGCGGAGCCCATCCTTTGGA
GAGGACTACTATGGACCTTCACGTTCTCGTCATCGTCGGCGATCGCGGGAGAGGGGGCCATACCGGACCCGCAAGCATGC
CCACCACTGCCACAAACGCCGCACCAGGTCTTGTAGCAGCGCCTCCTCGAGAAGCCAACAGAGCAGTAAGCGCAGCAGCC
GGAGTGTGGAAGATGACAAGGAGGGTCACCTGGTGTGCCGGATCGGCGATTGGCTCCAAGAGCGATATGAGTCTCAGGTT
GCCCTGAAGATCATCCGCAACGTGGGCAAGTACCGGGAGGCTGCCCGGCTAGAAATCAACGTGCTCAAAAAAATCAAGGA
GAAGGACAAAGAAAACAAGTTCCTGTGTGTCTTGATGTCTGACTGGTTCAACTTCCACGGTCACATGTGCATCGCCTTTG
AGCTCCTGGGCAAGAACACCTTTGAGTTCCTGAAGGAGAATAACTTCCAGCCTTACCCCCTACCACATGTCCGGCACATG
GCCTACCAGCTCTGCCACGCCCTTAGATTTCTGCATGAGAATCAGCTGACCCATACAGACTTGAAACCAGAGAACATCCT
GTTTGTGAATTCTGAGTTTGAAACCCTCTACAATGAGCACAAGAGCTGTGAGGAGAAGTCAGTGAAGAACACCAGCATCC
GAGTGGCTGACTTTGGCAGTGCCACATTTGACCATGAGCACCACACCACCATTGTGGCCACCCGTCACTATCGCCCGCCT
GAGGTGATCCTTGAGCTGGGCTGGGCACAGCCCTGTGACGTCTGGAGCATTGGCTGCATTCTCTTTGAGTACTACCGGGG
CTTCACACTCTTCCAGACCCACGAAAACCGAGAGCACCTGGTGATGATGGAGAAGATCCTAGGGCCCATCCCATCACACA
TGATCCACCGTACCAGGAAGCAGAAATATTTCTACAAAGGGGGCCTAGTTTGGGATGAGAACAGCTCTGACGGCCGGTAT
GTGAAGGAGAACTGCAAACCTCTGAAGAGTTACATGCTCCAAGACTCCCTGGAGCACGTGCAGCTGTTTGACCTGATGAG
GAGGATGTTAGAATTTGACCCTGCCCAGCGCATCACACTGGCCGAGGCCCTGCTGCACCCCTTCTTTGCTGGCCTGACCC
CTGAGGAGCGGTCCTTCCACACCAGCCGCAACCCAAGCAGATAG

Protein (467aa)

>JHU00021
MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFG
EDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYESQV
ALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHM
AYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPP
EVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRY
VKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR