Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU02061 MDFI Homo sapiens Yes Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
29 22 29 JHU02061
29 22 30 JHU02061
14 26 13 JHU02061
14 26 14 JHU02061
HuProt v3.0
Block Row Column Clone
17 19 31 JHU02061
17 20 31 JHU02061
21 1 29 JHU02061
21 2 29 JHU02061
HuProt v3.1
Block Row Column Clone
17 19 31 JHU02061
17 20 31 JHU02061
21 1 29 JHU02061
21 2 29 JHU02061

External Database ID

Nucleotide (741bp)

>JHU02061
ATGTACCAGGTGAGCGGCCAGCGCCCCTCTGGCTGCGACGCGCCCTATGGAGCCCCCAGCGCAGCCCCGGGCCCAGCCCA
GACCCTATCCCTCCTTCCTGGGCTGGAGGTAGTAACAGGATCCACTCACCCTGCGGAGGCAGCACCAGAGGAGGGCTCCC
TGGAGGAGGCGGCAACCCCCATGCCCCAAGGCAATGGCCCTGGCATCCCCCAGGGCCTGGACAGCACTGACCTCGACGTC
CCCACAGAAGCTGTGACATGCCAGCCTCAGGGGAACCCCTTGGGCTGCACCCCACTTCTGCCGAATGACTCTGGCCACCC
CTCAGAGCTGGGCGGCACCAGACGGGCGGGGAATGGTGCCCTGGGTGGCCCCAAGGCCCACCGGAAGTTGCAGACACACC
CATCTCTCGCCAGCCAGGGCAGCAAGAAGAGTAAGAGCAGCAGCAAATCCACCACCTCCCAGATCCCCCTCCAGGCACAG
GAAGACTGCTGTGTCCACTGCATCCTGTCCTGCCTGTTCTGCGAGTTCCTGACGCTGTGCAACATCGTCCTGGACTGCGC
CACCTGTGGCTCCTGCAGCTCGGAGGACTCGTGCCTCTGCTGCTGCTGCTGTGGCTCTGGCGAGTGTGCCGACTGCGACC
TGCCCTGCGACCTGGACTGCGGCATCCTGGATGCCTGCTGCGAGTCCGCGGACTGCCTGGAGATCTGCATGGAGTGCTGT
GGGCTCTGCTTCTCCTCCTAG

Protein (246aa)

>JHU02061
MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIPQGLDSTDLDV
PTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQ
EDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECC
GLCFSS