Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00201 ARL8B ARL10C;GIE1 Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
25 1 13 JHU00201
25 1 14 JHU00201
HuProt v3.0
Block Row Column Clone
1 1 25 JHU00201
1 2 25 JHU00201
HuProt v3.1
Block Row Column Clone
1 1 25 JHU00201
1 2 25 JHU00201

External Database ID

Nucleotide (561bp)

>JHU00201
ATGCTGGCGCTCATCTCCCGCCTGCTGGACTGGTTCCGTTCGCTCTTCTGGAAGGAAGAGATGGAGCTGACGCTCGTGGG
GCTGCAGTACTCGGGCAAGACCACCTTCGTCAATGTCATCGCGTCAGGTCAATTCAGTGAAGATATGATACCCACAGTGG
GCTTCAACATGAGGAAGGTAACTAAAGGTAACGTCACAATAAAGATCTGGGACATAGGAGGACAACCCCGATTTCGAAGC
ATGTGGGAGCGGTATTGCAGAGGAGTCAATGCTATTGTTTACATGATAGATGCTGCAGATCGTGAAAAGATAGAAGCTTC
CCGAAATGAGCTACATAATCTTCTAGATAAACCACAGTTACAAGGAATTCCAGTGCTAGTGCTTGGAAACAAGAGAGATC
TTCCTAATGCCTTGGATGAGAAACAGCTAATTGAAAAAATGAATCTGTCTGCTATTCAGGATAGAGAAATTTGCTGCTAT
TCAATTTCTTGCAAAGAAAAGGATAATATAGATATCACACTTCAGTGGCTTATTCAGCATTCAAAATCTAGAAGAAGCTA
G

Protein (186aa)

>JHU00201
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRS
MWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCY
SISCKEKDNIDITLQWLIQHSKSRRS