Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00200 ARL4D ARF4L Homo sapiens Yes Membrane Proteins; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
1 1 5 JHU00200
1 1 6 JHU00200
HuProt v3.0
Block Row Column Clone
3 1 1 JHU00200
3 2 1 JHU00200
HuProt v3.1
Block Row Column Clone
3 1 1 JHU00200
3 2 1 JHU00200

External Database ID

Nucleotide (606bp)

>JHU00200
ATGGGGAACCACTTGACTGAGATGGCGCCCACTGCCTCCTCCTTCTTGCCCCACTTCCAAGCCCTGCATGTCGTGGTCAT
TGGGCTGGACTCTGCTGGAAAGACCTCCCTCCTTTACCGCCTCAAGTTCAAGGAGTTTGTCCAGAGTGTCCCCACCAAAG
GCTTCAACACCGAGAAGATCCGGGTGCCCCTCGGGGGATCGCGTGGCATCACCTTCCAAGTGTGGGACGTCGGGGGGCAG
GAGAAGCTGCGACCACTGTGGCGCTCTTATACCCGCCGGACAGACGGTCTAGTGTTTGTGGTGGACGCTGCGGAGGCTGA
GCGGCTGGAGGAAGCCAAGGTGGAGTTGCACCGAATCAGCCGGGCCTCGGACAACCAGGGCGTGCCAGTGCTGGTGCTGG
CCAACAAGCAGGACCAGCCCGGGGCACTGAGCGCTGCTGAGGTGGAGAAGAGGCTGGCAGTCCGAGAGCTAGCAGCCGCC
ACTCTCACTCATGTGCAAGGCTGCAGCGCTGTGGACGGTCTGGGCCTGCAGCAGGGCCTTGAGCGCCTCTATGAGATGAT
CCTCAAGAGGAAGAAGGCAGCTCGGGGTGGCAAGAAGAGACGGTAG

Protein (201aa)

>JHU00200
MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQ
EKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAA
TLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR