Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00020 CKS2 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
12 1 15 JHU00020
12 1 16 JHU00020
HuProt v3.0
Block Row Column Clone
1 3 26 JHU00020
1 4 26 JHU00020
HuProt v3.1
Block Row Column Clone
1 3 26 JHU00020
1 4 26 JHU00020

External Database ID

Nucleotide (240bp)

>JHU00020
ATGGCCCACAAGCAGATCTACTACTCGGACAAGTACTTCGACGAACACTACGAGTACCGGCATGTTATGTTACCCAGAGA
ACTTTCCAAACAAGTACCTAAAACTCATCTGATGTCTGAAGAGGAGTGGAGGAGACTTGGTGTCCAACAGAGTCTAGGCT
GGGTTCATTACATGATTCATGAGCCAGAACCACATATTCTTCTCTTTAGACGACCTCTTCCAAAAGATCAACAAAAATAG

Protein (79aa)

>JHU00020
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK