Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00002 DGUOK DGK Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
HuProt v3.0
Block Row Column Clone
HuProt v3.1
Block Row Column Clone
24 43 10 JHU00002
24 44 10 JHU00002

External Database ID

Nucleotide (270bp)

>JHU00002
ATGGCCGCGGGCCGCCTCTTTCTAAGTCGGCTTCGAGCACCCTTCAGTTCCATGGCCAAGAGCCCACTCGAGGGCGTTTC
CTCCTCCAGAGGCCTGCACGCGGGGCGCGGGCCCCGAAGGCTCTCCATCGAAGGCAACATTGGCCTGCACTGCCCAAAGT
CTTGGAAACTTGCTGGATATGATGTACCGGGAGCCAGCACGATGGTCCTACACATTCCAGACATTTTCCTTTTTGAGCCG
CCTGAAAGTACAGCTGGAGCCCTTCCCTGA

Protein (89aa)

>JHU00002
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEP
PESTAGALP