Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00195 AKR1E2 AKR1CL2;AKRDC1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
27 1 7 JHU00195
27 1 8 JHU00195
HuProt v3.0
Block Row Column Clone
3 5 16 JHU00195
3 6 16 JHU00195
HuProt v3.1
Block Row Column Clone
3 5 16 JHU00195
3 6 16 JHU00195

External Database ID

Nucleotide (924bp)

>JHU00195
ATGGGAGATATCCCAGCCGTGGGCCTCAGCTCCTGGAAGGCTTCTCCAGGGAAAGTGACCGAGGCAGTGAAAGAGGCCAT
TGACGCAGGGTACCGGCACTTCGACTGTGCTTACTTTTACCACAATGAGAGGGAGGTTGGAGCAGGGATCCGTTGCAAGA
TCAAGGAAGGCGCTGTAAGACGGGAGGATCTGTTCATTGCCACTAAGCTGTGGTGCACCTGCCATAAGAAGTCCTTGGTG
GAAACAGCATGCAGAAAGAGTCTCAAGGCCTTGAAGCTGAACTATTTGGACCTCTACCTCATACACTGGCCCATGGGTTT
CAAGCCTCCTCATCCAGAATGGATCATGAGCTGCAGTGAACTTTCCTTCTGCCTCTCACATCCTCGAGTGCAGGACTTGC
CTCTGGACGAGAGCAACATGGTTATTCCCAGTGACACGGACTTCCTGGACACGTGGGAGGCCATGGAGGACCTGGTGATC
ACCGGGCTGGTGAAGAACATCGGGGTGTCAAACTTCAACCATGAACAGCTTGAGAGGCTTTTGAATAAGCCTGGGTTGAG
GTTCAAGCCACTAACCAACCAGATTGAGTGCCACCCATATCTTACTCAGAAGAATCTGATCAGTTTTTGCCAATCCAGAG
ATGTGTCCGTGACTGCTTACCGTCCTCTTGGTGGCTCGTGTGAGGGGGTTGACCTGATAGACAACCCTGTGATCAAGAGG
ATTGCAAAGGAGCACGGCAAGTCTCCTGCTCAGATTTTGATCCGATTTCAAATCCAGAGGAATGTGATAGTGATCCCCGG
ATCTATCACCCCAAGTCACATTAAAGAGAATATCCAGGTGTTTGATTTTGAATTAACACAGCACGATATGGATAACATCC
TCAGCCTAAACAGGAATCTCCGACTGGCCATGTTCCCCATGTAG

Protein (307aa)

>JHU00195
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLV
ETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVI
TGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKR
IAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM