Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00191 UHMK1 KIS;KIST Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
30 1 5 JHU00191
30 1 6 JHU00191
HuProt v3.0
Block Row Column Clone
3 1 27 JHU00191
3 2 27 JHU00191
HuProt v3.1
Block Row Column Clone
3 1 27 JHU00191
3 2 27 JHU00191

External Database ID

Nucleotide (1035bp)

>JHU00191
ATGGCGGGATCCGGCTGCGCCTGGGGCGCGGAGCCGCCGCGTTTTCTGGAGGCCTTCGGGCGGCTGTGGCAGGTACAGAG
CCGTCTGGGTAGCGGCTCCTCCGCCTCGGTGTATCGGGTTCGCTGCTGCGGCAACCCTGGCTCGCCCCCCGGCGCCCTCA
AGCAGTTCTTGCCGCCAGGAACCACCGGGGCTGCGGCCTCTGCCGCCGAGTATGGTTTCCGCAAAGAGAGGGCGGCGCTG
GAACAGTTGCAGGGTCACAGAAACATCGTGACTTTGTATGGAGTGTTTACAATCCACTTTTCTCCAAATGTGCCATCACG
CTGTCTGTTGCTTGAACTCCTGGATGTCAGTGTTTCGGAATTGCTCTTATATTCCAGTCACCAGGGTTGTTCCATGTGGA
TGATACAGCATTGTGCCCGAGATGTTTTGGAGGCCCTTGCTTTTCTTCATCATGAGGGCTATGTCCATGCGGACCTCAAA
CCACGTAACATATTGTGGAGTGCAGAGAATGAATGTTTTAAACTCATTGACTTTGGACTTAGCTTCAAAGAAGGCAATCA
GGATGTAAAGTATATTCAGACAGACGGGTATCGGGCTCCAGAAGCAGAATTGCAAAATTGCTTGGCCCAGGCTGGCCTGC
AGAGTGATACAGAATGTACCTCAGCTGTTGATCTGTGGAGCCTAGGAATCATTTTACTGGAAATGTTCTCAGGAATGAAA
CTGAAACATACAGTCAGATCTCAGGAATGGAAGGCAAACAGTTCTGCTACTATTGATCACATATTTGCCAGTAAAGCAGT
GGTGAATGCCGCAATTCCAGCCTATCACCTAAGAGACCTTATCAAAAGCATGCTTCATGATGATCCAAGCAGAAGAATTC
CTGCTGAAATGGCATTGTGCAGCCCATTCTTTAGCATTCCTTTTGCCCCTCATATTGAAGATCTGGTCATGCTTCCCACT
CCAGTGCTAAGACTGCTGAATGTGCTGGATGATGATTATCTTGAGAATGAAGAGGAATATGAAGGTCTTTGTTAG

Protein (344aa)

>JHU00191
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAAL
EQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLK
PRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMK
LKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPT
PVLRLLNVLDDDYLENEEEYEGLC