Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00018 CKM CKMM Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
12 24 17 JHU00018
12 24 18 JHU00018
HuProt v3.0
Block Row Column Clone
20 43 12 JHU00018
20 44 12 JHU00018
HuProt v3.1
Block Row Column Clone
20 43 12 JHU00018
20 44 12 JHU00018

External Database ID

Nucleotide (1146bp)

>JHU00018
ATGCCATTCGGTAACACCCACAACAAGTTCAAGCTGAATTACAAGCCTGAGGAGGAGTACCCCGACCTCAGCAAACATAA
CAACCACATGGCCAAGGTACTGACCCTTGAACTCTACAAGAAGCTGCGGGACAAGGAGACTCCATCTGGCTTCACTGTAG
ACGATGTCATCCAGACAGGAGTGGACAACCCAGGTCACCCCTTCATCATGACCGTGGGCTGCGTGGCTGGTGATGAGGAG
TCCTACGAAGTTTTCAAGGAACTCTTTGACCCCATCATCTCGGATCGCCACGGGGGCTACAAACCCACTGACAAGCACAA
GACTGACCTCAACCATGAAAACCTCAAGGGTGGAGACGACCTGGACCCCAACTACGTGCTCAGCAGCCGCGTCCGCACTG
GCCGCAGCATCAAGGGCTACACGTTGCCCCCACACTGCTCCCGTGGCGAGCGCCGGGCGGTGGAGAAGCTCTCTGTGGAA
GCTCTCAACAGCCTGACGGGCGAGTTCAAAGGGAAGTACTACCCTCTGAAGAGCATGACGGAGAAGGAGCAGCAGCAGCT
CATCGATGACCACTTCCTGTTCGACAAGCCCGTGTCCCCGCTGCTGCTGGCCTCAGGCATGGCCCGCGACTGGCCCGACG
CCCGTGGCATCTGGCACAATGACAACAAGAGCCTCCTGGTGTGGGTGAACGAGGAGGATCACCTCCGGGTCATCTCCATG
GAGAAGGGGGGCAACATGAAGGAGGTTTTCCGCCGCTTCTGCGTAGGGCTGCAGAAGATTGAGGAGATCTTTAAGAAAGC
TGGCCACCCCTTCATGTGGAACCAGCACCTGGGCTACGTGCTCACCTGCCCATCCAACCTGGGCACTGGGCTGCGTGGAG
GCGTGCATGTGAAGCTGGCGCACCTGAGCAAGCACCCCAAGTTCGAGGAGATCCTCACCCGCCTGCGTCTGCAGAAGAGG
GGTACAGGTGGCGTGGACACAGCTGCCGTGGGCTCAGTATTTGACGTGTCCAACGCTGATCGGCTGGGCTCGTCCGAAGT
AGAACAGGTGCAGCTGGTGGTGGATGGTGTGAAGCTCATGGTGGAAATGGAGAAGAAGTTGGAGAAAGGCCAGTCCATCG
ACGACATGATCCCCGCCCAGAAGTAG

Protein (381aa)

>JHU00018
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEE
SYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVE
ALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKR
GTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK