Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17358 MIB2 Homo sapiens No Kinases

HuProt v2.0
Block Row Column Clone
23 26 1 JHU17358
23 26 2 JHU17358
13 26 3 JHU17358
13 26 4 JHU17358
21 26 5 JHU17358
21 26 6 JHU17358
47 26 31 JHU17358
47 26 32 JHU17358
5 26 31 JHU17358
5 26 32 JHU17358
20 27 1 JHU17358
20 27 2 JHU17358
HuProt v3.0
Block Row Column Clone
24 1 18 JHU17358
24 2 18 JHU17358
24 3 31 JHU17358
24 4 31 JHU17358
23 1 21 JHU17358
23 2 21 JHU17358
21 11 28 JHU17358
21 12 28 JHU17358
21 9 21 JHU17358
21 10 21 JHU17358
24 13 20 JHU17358
24 14 20 JHU17358
HuProt v3.1
Block Row Column Clone
24 1 18 JHU17358
24 2 18 JHU17358
24 3 31 JHU17358
24 4 31 JHU17358
23 1 21 JHU17358
23 2 21 JHU17358
21 11 28 JHU17358
21 12 28 JHU17358
21 9 21 JHU17358
21 10 21 JHU17358
24 13 20 JHU17358
24 14 20 JHU17358

External Database ID

Nucleotide (2997bp)

>JHU17358
ATGGGTTGGAAGCCCAGCGAGGCTAGAGGCCAGTCCCAAAGTTTCCAGGCATCAGGGCTGCAGCCCAGGAGCCTCAAGGC
GGCCCGGCGGGCGACTGGACGGCCGGACAGGTCCCGAGCAGCCCCGCCCAACATGGACCCAGACCCCCAGGCGGGCGTGC
AGGTGGGCATGCGGGTGGTGCGCGGCGTGGACTGGAAGTGGGGCCAGCAGGACGGCGGCGAGGGCGGCGTGGGCACGGTG
GTGGAGCTTGGCCGCCACGGCAGCCCCTCGACACCCGACCGCACAGTGGTCGTGCAGTGGGACCAGGGCACGCGCACCAA
CTACCGCGCCGGCTACCAGGGCGCGCACGACCTGCTGCTGTACGACAACGCCCAGATCGGCGTCCGGCACCCCAACATCA
TCTGTGACTGCTGCAAGAAGCACGGGCTGCGGGGGATGCGCTGGAAGTGCCGTGTGTGCCTGGACTACGACCTCTGCACG
CAGTGCTACATGCACAACAAGCATGAGCTCGCCCACGCCTTCGACCGCTACGAGACCGCTCACTCGCGCCCTGTCACACT
GAGTCCCCGCCAGGGCCTCCCGAGGATCCCACTAAGGGGCATCTTCCAGGGAGCGAAGGTGGTGCGAGGCCCCGACTGGG
AGTGGGGCTCACAGGATGGAGGGGAAGGGAAACCGGGCCGTGTGGTGGACATCCGTGGCTGGGATGTGGAGACAGGCCGG
AGTGTGGCCAGCGTGACGTGGGCTGATGGTACCACCAATGTGTACCGTGTGGGCTACAAGGGCAAGGTGGACCTCAAGTG
TGTGGGCGAGGCAGCGGGCGGCTTCTACTACAAGGACCACCTCCCAAGGCTCGGCAAGCCGGCGGAGCTGCAGCGCAGGG
TGAGTGCTGACAGCCAGCCCTTCCAGCACGGGGACAAGGTCAAGTGTCTGCTGGACACTGATGTCCTGCGGGAGATGCAG
GAAGGCCACGGCGGCTGGAACCCCAGGATGGCGGAGTTTATCGGACAGACGGGCACCGTGCATCGTATCACGGACCGCGG
GGACGTGCGCGTGCAGTTCAACCACGAGACGCGCTGGACCTTCCACCCCGGGGCGCTCACCAAGCACCACTCCTTCTGGG
TGGGCGACGTGGTCCGGGTCATCGGCGACCTTGACACAGTGAAGCGGCTGCAGGCTGGGCATGGCGAGTGGACGGACGAC
ATGGCCCCTGCCCTGGGCCGCGTCGGGAAGGTGGTGAAAGTGTTTGGAGACGGGAACCTGCGTGTAGCAGTCGCTGGTCA
GCGGTGGACCTTCAGCCCCTCCTGCCTGGTGGCCTACCGGCCCGAGGAGGATGCCAACCTGGACGTGGCCGAGCGCGCCC
GGGAGAACAAAAGCTCACTGAGCGTGGCCCTGGACAAGCTTCGGGCCCAGAAGAGTGACCCAGAGCACCCGGGAAGGCTG
GTGGTGGAGGTGGCGCTGGGTAACGCAGCCCGGGCTCTGGGCCTGCTGCGGAGGCGCCCAGAGCAGGTGGACACCAAGAA
CCAAGGCAGGACCGCTCTGCAAGTGGCTGCCTACCTGGGCCAGGTGGAGTTGATACGGCTGCTGCTACAAGCCAGGGCGG
GCGTGGACCTGCCGGACGACGAGGGCAACACGGCACTGCACTACGCGGCCCTGGGGAACCAGCCCGAGGCCACCAGGGTG
CTCCTGAGTGCTGGGTGCCGGGCGGACGCCATCAACAGCACCCAGAGCACAGCACTGCACGTGGCCGTGCAGAGGGGCTT
CCTGGAGGTGGTGCGGGCCCTGTGTGAGCGCGGCTGTGACGTCAACCTGCCCGACGCCCACTCGGACACGCCCCTGCACT
CCGCCATCTCGGCGGGCACTGGAGCCGGCGGCATTGTCGAGGTCCTCACGGAGGTGCCAAACATCGATGTTACCGCCACC
AACAGCCAGGGTTTCACCCTGCTGCACCATGCCTCCCTCAAGGGTCACGCGCTAGCTGTGAGAAAGATTCTGGCTCGGGC
GCGGCAGCTGGTGGACGCCAAGAAGGAGGACGGCTTCACGGCGCTGCATCTGGCTGCCCTCAACAACCACCGCGAGGTGG
CCCAGATCCTCATCCGGGAGGGCCGCTGTGACGTGAACGTGCGCAACCGGAAGCTGCAGTCCCCGCTGCATCTCGCCGTG
CAACAGGCCCACGTGGGGCTGGTGCCGCTACTGGTGGACGCTGGGTGCAGTGTCAACGCCGAGGACGAGGAGGGGGACAC
AGCCCTGCACGTGGCGCTGCAGCGTCATCAGCTGCTGCCCCTGGTGGCTGATGGGGCCGGGGGGGACCCAGGGCCCTTGC
AGCTGCTGTCCAGGCTACAGGCCTCGGGCCTCCCCGGCAGCGCGGAGCTGACGGTGGGCGCGGCGGTCGCCTGCTTCCTG
GCGCTGGAGGGCGCCGACGTGAGCTACACCAACCACCGCGGTCGGAGCCCGCTGGACCTGGCCGCCGAGGGTCGCGTGCT
CAAGGCCCTTCAGGGCTGCGCCCAGCGCTTCCGGGAGCGGCAGGCGGGCGGGGGCGCGGCCCCGGGCCCCAGGCAAACGC
TCGGGACCCCCAACACCGTGACGAACCTGCACGTGGGCGCCGCGCCGGGGCCCGAGGCCGCTGAGTGCCTGGTGTGCTCC
GAGCTGGCGCTGCTGGTGCTGTTCTCGCCGTGCCAGCACCGCACCGTGTGTGAGGAGTGCGCGCGCAGGATGAAGAAGTG
CATCAGGTGCCAGGTGGTCGTCAGCAAGAAACTGCGCCCAGACGGCTCTGAGGTGGCGAGCGCCGCCCCCGCCCCCGGCC
CGCCGCGCCAGCTGGTGGAGGAGCTGCAGAGCCGCTACCGGCAGATGGAGGAACGCATCACCTGCCCCATCTGCATCGAC
AGCCACATCCGCCTCGTGTTCCAGTGCGGCCACGGCGCATGCGCCCCCTGCGGCTCCGCGCTCAGCGCCTGCCCCATCTG
CCGCCAGCCCATCCGCGACCGCATCCAGATCTTCGTG

Protein (999aa)

>JHU17358
MGWKPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAAPPNMDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTV
VELGRHGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCT
QCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRVVDIRGWDVETGR
SVASVTWADGTTNVYRVGYKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQ
EGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDD
MAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL
VVEVALGNAARALGLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRV
LLSAGCRADAINSTQSTALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGAGGIVEVLTEVPNIDVTAT
NSQGFTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAV
QQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFL
ALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCS
ELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRYRQMEERITCPICID
SHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV