Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00178 RPH3A KIAA0985 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
22 1 9 JHU00178
22 1 10 JHU00178
HuProt v3.0
Block Row Column Clone
2 1 17 JHU00178
2 2 17 JHU00178
HuProt v3.1
Block Row Column Clone
2 1 17 JHU00178
2 2 17 JHU00178

External Database ID

Nucleotide (2073bp)

>JHU00178
ATGACTGACACCGTGTTCAGCAACAGTTCTAACCGTTGGATGTACCCCAGTGACCGGCCCCTTCAATCAAAGCTCCAGGC
AGGCTGGTCCGTCCACCCCGGTGGTCAGCCTGACAGGCAGAGGAAGCAGGAAGAGCTGACTGATGAGGAGAAAGAAATCA
TCAACAGGGTGATTGCTCGAGCTGAGAAAATGGAAGAGATGGAGCAGGAGCGAATCGGACGCCTGGTGGACCGCCTAGAA
AACATGAGGAAGAACGTGGCTGGAGATGGGGTGAACCGCTGCATACTGTGTGGAGAACAGCTGGGGATGCTGGGCTCTGC
CTGTGTAGTATGTGAGGACTGTAAGAAGAACGTCTGCACCAAGTGCGGAGTGGAGACCAACAACCGCCTGCATTCTGTGT
GGCTCTGCAAAATCTGCATTGAGCAGAGGGAGGTGTGGAAGCGTTCTGGAGCGTGGTTCTTCAAAGGCTTCCCCAAACAG
GTCCTCCCACAGCCTATGCCTATAAAGAAGACCAAGCCCCAGCAGCCTGTCAGTGAGCCTGCTGCCCCTGAACAGCCTGC
TCCTGAGCCCAAGCACCCTGCCCGGGCTCCAGCTCGAGGTGACAGTGAAGATAGGAGGGGCCCGGGTCAGAAGACAGGCC
CTGACCCAGCCTCTGCTCCCGGGCGAGGAAACTATGGGCCTCCCGTGCGCAGGGCCTCCGAGGCACGAATGAGCTCATCT
AGCCGAGATTCAGAGAGCTGGGACCACAGTGGGGGTGCTGGAGACTCCAGCCGGAGCCCAGCAGGTTTGAGACGGGCCAA
CTCAGTCCAGGCCTCCAGACCTGCCCCAGGCTCGGTGCAGAGCCCAGCGCCACCTCAGCCTGGGCAGCCAGGGACCCCAG
GAGGAAGCAGACCGGGTCCTGGGCCAGCAGGACGCTTTCCAGATCAGAAGCCAGAGGTGGCTCCGAGCGACCCTGGGACC
ACTGCCCCACCCCGAGAGGAGAGAACAGGGGGAGTCGGGGGCTACCCAGCAGTTGGAGCCAGAGAGGACCGAATGAGCCA
CCCCTCCGGACCCTATTCCCAAGCATCTGCAGCTGCCCCCCAGCCTGCTGCAGCCCGCCAGCCACCACCCCCAGAGGAGG
AGGAAGAGGAAGCCAACAGCTACGATTCGGATGAAGCAACCACCCTGGGTGCCCTGGAATTCAGCCTTCTCTACGACCAG
GACAACAGCTCCCTGCAGTGCACCATCATTAAGGCCAAGGGCCTGAAGCCCATGGATTCAAATGGCTTGGCTGATCCCTA
CGTTAAGCTGCACCTCCTGCCGGGAGCCAGCAAGTCCAACAAGCTTCGTACAAAAACTCTGCGGAATACCCGGAACCCCA
TCTGGAATGAGACCCTCGTGTATCACGGCATCACCGATGAGGACATGCAAAGGAAGACCCTCAGGATCTCCGTCTGTGAT
GAGGACAAATTCGGCCACAATGAATTTATTGGTGAGACCAGATTCTCCCTCAAGAAACTGAAGCCCAACCAGAGGAAGAA
TTTCAACATCTGCCTGGAGCGAGTGATTCCTATGAAACGTGCTGGGACCACCGGGTCAGCCCGAGGCATGGCCCTTTATG
AGGAAGAGCAGGTGGAGCGTGTTGGTGACATCGAGGAGCGTGGCAAGATCCTGGTCTCCCTCATGTACAGCACACAGCAG
GGAGGCCTCATTGTGGGCATCATACGCTGCGTGCACCTGGCTGCCATGGACGCTAATGGCTACTCAGACCCATTCGTCAA
GCTCTGGCTGAAACCGGACATGGGAAAGAAGGCCAAACACAAGACTCAAATTAAAAAGAAAACCTTGAATCCCGAATTCA
ATGAGGAGTTTTTCTATGACATCAAACACAGTGACCTGGCAAAGAAGTCACTGGACATTTCAGTCTGGGACTATGACATC
GGCAAGTCCAATGATTACATCGGAGGCTGCCAGCTGGGGATCTCTGCCAAGGGAGAGCGCTTAAAACACTGGTACGAGTG
TCTGAAAAATAAAGACAAGAAGATAGAGCGCTGGCACCAGCTACAGAATGAGAACCACGTGTCAAGTGATTAG

Protein (690aa)

>JHU00178
MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLE
NMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQ
VLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSS
SRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGSRPGPGPAGRFPDQKPEVAPSDPGT
TAPPREERTGGVGGYPAVGAREDRMSHPSGPYSQASAAAPQPAAARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQ
DNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCD
EDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMYSTQQ
GGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDI
GKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENHVSSD