Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17281 TWF1 PTK9 Homo sapiens No Kinases

HuProt v2.0
Block Row Column Clone
31 26 5 JHU17281
31 26 6 JHU17281
47 26 5 JHU17281
47 26 6 JHU17281
13 26 5 JHU17281
13 26 6 JHU17281
HuProt v3.0
Block Row Column Clone
23 1 28 JHU17281
23 2 28 JHU17281
23 3 30 JHU17281
23 4 30 JHU17281
23 1 13 JHU17281
23 2 13 JHU17281
HuProt v3.1
Block Row Column Clone
23 1 28 JHU17281
23 2 28 JHU17281
23 3 30 JHU17281
23 4 30 JHU17281
23 1 13 JHU17281
23 2 13 JHU17281

External Database ID

Nucleotide (1152bp)

>JHU17281
ATGACGCGCCGGGGCCGGCGGAGGAGCAGCCACTTCCTGGGGCCGCCGGCCGGGGCCGCTGGCTGCACTCAGCGCCGGAG
CCGGGAGCTAGCGGCCGCCGCCATGTCCCACCAGACCGGCATCCAAGCAAGTGAAGATGTTAAAGAGATCTTTGCCAGAG
CCAGAAATGGAAAGTACAGACTTCTGAAAATATCTATTGAAAATGAGCAACTTGTGATTGGATCATATAGTCAGCCTTCA
GATTCCTGGGATAAGGATTATGATTCCTTTGTTTTACCCCTGTTGGAGGACAAACAACCATGCTATATATTATTCAGGTT
AGATTCTCAGAATGCCCAGGGATATGAATGGATATTCATTGCATGGTCTCCAGATCATTCTCATGTTCGTCAAAAAATGT
TGTATGCAGCAACAAGAGCAACTCTGAAGAAGGAATTTGGAGGTGGCCACATTAAAGATGAAGTATTTGGAACAGTAAAG
GAAGATGTATCATTACATGGATATAAAAAATACTTGCTGTCACAATCTTCCCCTGCCCCACTGACTGCAGCTGAGGAAGA
ACTACGACAGATTAAAATCAATGAGGTACAGACTGACGTGGGTGTGGACACTAAGCATCAAACACTACAAGGAGTAGCAT
TTCCCATTTCTCGAGAAGCCTTTCAGGCTTTGGAAAAATTGAATAATAGACAGCTCAACTATGTGCAGTTGGAAATAGAT
ATAAAAAATGAAATTATAATTTTGGCCAACACAACAAATACAGAACTGAAAGATTTGCCAAAGAGGATTCCCAAGGATTC
AGCTCGTTACCATTTCTTTCTGTATAAACATTCCCATGAAGGAGACTATTTAGAGTCCATAGTTTTTATTTATTCAATGC
CTGGATACACATGCAGTATAAGAGAGCGGATGCTGTATTCTAGCTGCAAGAGCCGTCTGCTAGAAATTGTAGAAAGACAA
CTACAAATGGATGTAATTAGAAAGATCGAGATAGACAATGGGGATGAGTTGACTGCAGACTTCCTTTATGAAGAAGTACA
TCCCAAGCAGCATGCACACAAGCAAAGTTTTGCAAAACCAAAAGGTCCTGCAGGAAAAAGAGGAATTCGAAGACTAATTA
GGGGCCCAGCGGAAACTGAAGCTACTACTGAT

Protein (384aa)

>JHU17281
MTRRGRRRSSHFLGPPAGAAGCTQRRSRELAAAAMSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPS
DSWDKDYDSFVLPLLEDKQPCYILFRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDEVFGTVK
EDVSLHGYKKYLLSQSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEID
IKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSRLLEIVERQ
LQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAETEATTD