Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17278 TEX14 SGK307 Homo sapiens No Kinases

HuProt v2.0
Block Row Column Clone
5 26 5 JHU17278
5 26 6 JHU17278
HuProt v3.0
Block Row Column Clone
23 1 7 JHU17278
23 2 7 JHU17278
HuProt v3.1
Block Row Column Clone
23 1 7 JHU17278
23 2 7 JHU17278

External Database ID

Nucleotide (4491bp)

>JHU17278
ATGTCTCGGGCTGTTCGTCTTCCAGTCCCCTGTCCTGTTCAACTTGGTACCTTAAGAAATGACTCCCTGGAAGCTCAGCT
TCATGAGTATGTCAAACAAGGGAACTATGTGAAAGTGAAGAAAATTCTTAAGAAAGGAATTTATGTTGATGCAGTTAACT
CCTTGGGCCAAACAGCACTTTTTGTTGCGGCGTTATTGGGCCTTAGGAAATTCGTTGATGTTCTGGTGGATTATGGATCA
GATCCAAATCACCGCTGCTTTGATGGGAGCACCCCTGTCCATGCAGCAGCATTTTCGGGCAATCAGTGGATCCTTAGCAA
ACTGCTGGATGCAGGAGGTGACCTGCGACTCCACGATGAGAGGGGTCAAAACCCGAAGACTTGGGCTTTGACAGCAGGAA
AGGAGCGTAGCACCCAGATAGTGGAGTTCATGCAGCGCTGTGCCTCACACATGCAGGCCATCATCCAGGGCTTCTCTTAC
GACCTCCTGAAGAAGATAGACTCCCCGCAGCGGCTTGTCTACAGCCCGTCCTGGTGTGGGGGCCTCGTGCAGGGAAACCC
TAATGGCTCTCCTAACCGACTGCTTAAAGCTGGAGTCATTTCTGCTCAAAATATCTACAGCTTTGGTTTTGGGAAGGCTA
TGCCTTGGTTTCAGTTTTATCTTACTGGGGCGACACAGATGGCCTATCTAGGATCTCTTCCGGTCATTGGAGAAAAGGAA
GTGATTCAAGCTGATGATGAGCCCACCTTCTCTTTCTTCAGCGGCCCCTACATGGTCATGACCAACCTAGTGTGGAATGG
GAGCAGGGTCACAGTGAAAGAGCTGAATCTCCCCACCCACCCACACTGCAGCAGGCTGCGGCTGGCCGACTTGTTAATTG
CCGAGCAGGAACACAGCAGCAAGCTGCGGCACCCCTACTTGCTACAGTTGATGGCTGTGTGTCTCTCCCAGGACCTAGAG
AAAACCCGCCTTGTGTACGAGCGCATCACTATCGGCACATTGTTCAGTGTCCTTCATGAACGACGGTCCCAGTTCCCAGT
GCTGCACATGGAGGTGATTGTGCACCTGCTGCTCCAGATATCTGATGCCCTGAGATACCTGCATTTCCAGGGGTTTATCC
ACCGCTCCCTCAGCTCCTATGCTGTCCATATCATCTCCCCTGGTGAAGCGAGGCTGACCAACCTGGAGTACATGTTGGAA
AGCGAGGACAGAGGTGTACAGAGGGACCTGACTCGAGTGCCCCTTCCTACGCAGCTATACAACTGGGCCGCACCAGAAGT
GATCTTACAGAAGGCAGCCACAGTGAAATCAGACATCTACAGCTTTTCTATGATCATGCAGGAGATTTTAACAGATGACA
TACCCTGGAAGGGCTTAGATGGCTCAGTTGTTAAAAAAGCCGTAGTCTCGGGGAATTATTTAGAAGCTGATGTCAGGCTT
CCGAAACCTTACTATGATATTGTTAAGTCAGGCATCCACGTCAAGCAGAAAGACCGAACTATGAACCTTCAAGATATCCG
GTATATTCTGAAGAATGACTTAAAGGATTTTACTGGAGCCCAGAGAACTCAACCAACCGAGAGCCCCAGAGTGCAGAGAT
ACGGACTCCATCCCGATGTCAATGTCTATCTAGGACTGACTTCAGAACACCCCAGAGAGACACCTGACATGGAAATCATA
GAACTAAAGGAAATGGGCAGTCAACCTCATTCACCAAGGGTTCACTCTTTATTCACTGAGGGGACACTAGATCCTCAGGC
CCCAGATCCATGTCTGATGGCCAGGGAGACTCAGAATCAAGATGCTCCTTGCCCTGCTCCATTTATGGCAGAAGAGGCCA
GCAGCCCCAGCACAGGTCAGCCAAGCCTCTGCAGTTTCGAAATCAACGAGATCTACTCAGGCTGCTTGATTTTGGAAGAT
GACATAGAAGAGCCTCCAGGAGCTGCTTCATCTTTGGAGGCAGACGGACCTAACCAGGTAGATGAACTGAAATCCATGGA
AGAAGAGCTGGATAAGATGGAGAGAGAGGCGTGTTGTTTTGGCAGTGAGGATGAGAGCTCTTCAAAAGCTGAGACAGAGT
ACTCTTTTGATGACTGGGACTGGCAAAACGGTTCACTCAGTTCACTCAGCCTTCCTGAGTCAACCAGAGAAGCCAAGAGC
AATTTGAACAACATGTCCACGACTGAGGAGTATCTCATCAGTAAGTGTGTGCTGGATCTAAAGATTATGCAGACAATAAT
GCACGAGAATGATGATAGGCTGAGGAATATCGAGCAGATATTAGATGAAGTCGAGATGAAACAGAAGGAACAGGAAGAGC
GCATGTCTTTATGGGCCACTTCAAGAGAGTTTACAAATGCCTACAAGTTACCTCTGGCCGTGGGCCCTCCATCTTTAAAC
TATATTCCTCCTGTCCTACAGCTTTCAGGGGGTCAGAAGCCAGACACCAGTGGCAACTACCCAACCCTACCAAGATTTCC
AAGAATGCTGCCGACTCTTTGTGACCCTGGAAAACAGAACACAGATGAACAATTTCAGTGCACTCAAGGAGCCAAGGACA
GTTTGGAAACAAGCAGGATCCAAAATACCAGTAGCCAGGGAAGACCTAGAGAGTCCACTGCCCAAGCCAAAGCCACACAG
TTTAATAGTGCACTCTTCACTCTGTCAAGCCACCGGCAGGGACCTTCTGCATCACCCAGCTGTCACTGGGACTCTACCAG
GATGAGTGTGGAACCTGTTTCTTCTGAAATCTATAATGCAGAGTCCAGAAATAAAGATGATGGAAAGGTACACTTAAAAT
GGAAAATGGAGGTGAAAGAAATGGCAAAGAAAGCAGCTACTGGACAGCTCACAGTACCTCCTTGGCATCCTCAGAGTAGT
CTGACTTTAGAGAGCGAGGCTGAAAATGAGCCCGACGCCCTGCTGCAGCCCCCCATTAGGAGCCCAGAAAACACGGATTG
GCAGCGAGTTATTGAGTATCATAGGGAAAATGATGAGCCCAGAGGAAATGGCAAGTTTGACAAGACGGGCAACAATGACT
GTGACAGTGACCAGCATGGCAGACAGCCCAGGCTTGGAAGCTTCACCAGTATCAGGCACCCATCTCCCAGACAAAAGGAG
CAACCAGAGCATAGTGAAGCCTTCCAAGCAAGTTCTGACACATTGGTGGCTGTAGAGAAATCTTACAGTCATCAGTCCAT
GCAATCAACTTGTTCACCAGAGTCTTCTGAGGATATAACAGATGAATTTTTAACTCCAGACGGTGAATATTTTTACTCCT
CGACTGCTCAAGAAAACTTAGCTCTAGAGACCTCGAGTCCCATAGAAGAGGACTTTGAAGGAATACAAGGTGCATTTGCC
CAACCTCAAGTCTCTGGTGAGGAAAAGTTCCAAATGAGAAAAATTCTTGGAAAGAATGCTGAGATTTTGCCCAGGTCTCA
ATTTCAACCTGTACGAAGTACTGAAGATGAACAAGAAGAGACATCAAAGGAGTCACCAAAGGAACTGAAAGAGAAAGACA
TATCATTGACGGATATTCAAGACCTGTCTAGTATCTCCTATGAACCAGACAGCTCTTTTAAGGAAGCTTCATGCAAAACA
CCCAAAATAAACCATGCACCTACCAGTGTCAGCACTCCACTCAGCCCAGGGTCCGTTTCTTCAGCTGCCAGTCAGTATAA
AGACTGCCTTGAAAGTATCACATTTCAGGTTAAGACAGAGTTTGCCTCTTGCTGGAACAGTCAAGAATTTATTCAAACTT
TGTCTGATGACTTTATAAGTGTCCGAGAGAGAGCAAAGAAACTGGATTCTCTCCTTACTTCCTCTGAAACTCCCCCTTCA
AGACTGACTGGTCTTAAAAGATTGTCTTCATTTATTGGGGCTGGATCCCCCAGCCTTGTTAAGGCATGTGACTCATCACC
ACCCCATGCCACCCAGAGAAGGAGCCTGCCTAAAGTAGAAGCCTTCTCACAGCATCACATTGATGAGCTGCCACCACCAT
CTCAGGAGCTACTTGATGACATTGAGCTCTTGAAACAGCAGCAGGGCTCATCCACGGTGTTGCATGAGAACACAGCAAGT
GATGGAGGAGGCACTGCAAATGATCAAAGGCACTTAGAAGAACAAGAAACTGACAGTAAAAAAGAAGATAGTAGTATGCC
TTTGTCCAAAGAAACTGAAGATCTTGGAGAGGACACAGAGAGAGCTCACTCTACTCTGGATGAGGACCTGGAAAGATGGC
TGCAGCCACCTGAGGAGAGCGTGGAGCTACAAGACCTTCCCAAGGGCTCTGAAAGGGAGACAAATATCAAAGATCAAAAA
GTTGGTGAAGAGAAAAGAAAAAGGGAAGATAGCATTACACCAGAGAGAAGGAAATCAGAGGGTGTTCTAGGGACTTCTGA
AGAAGATGAACTAAAATCCTGTTTTTGGAAGCGACTAGGTTGGTCCGAATCATCCAGGATAATCGTGCTGGATCAGAGTG
ACTTGTCAGAC

Protein (1497aa)

>JHU17278
MSRAVRLPVPCPVQLGTLRNDSLEAQLHEYVKQGNYVKVKKILKKGIYVDAVNSLGQTALFVAALLGLRKFVDVLVDYGS
DPNHRCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDERGQNPKTWALTAGKERSTQIVEFMQRCASHMQAIIQGFSY
DLLKKIDSPQRLVYSPSWCGGLVQGNPNGSPNRLLKAGVISAQNIYSFGFGKAMPWFQFYLTGATQMAYLGSLPVIGEKE
VIQADDEPTFSFFSGPYMVMTNLVWNGSRVTVKELNLPTHPHCSRLRLADLLIAEQEHSSKLRHPYLLQLMAVCLSQDLE
KTRLVYERITIGTLFSVLHERRSQFPVLHMEVIVHLLLQISDALRYLHFQGFIHRSLSSYAVHIISPGEARLTNLEYMLE
SEDRGVQRDLTRVPLPTQLYNWAAPEVILQKAATVKSDIYSFSMIMQEILTDDIPWKGLDGSVVKKAVVSGNYLEADVRL
PKPYYDIVKSGIHVKQKDRTMNLQDIRYILKNDLKDFTGAQRTQPTESPRVQRYGLHPDVNVYLGLTSEHPRETPDMEII
ELKEMGSQPHSPRVHSLFTEGTLDPQAPDPCLMARETQNQDAPCPAPFMAEEASSPSTGQPSLCSFEINEIYSGCLILED
DIEEPPGAASSLEADGPNQVDELKSMEEELDKMEREACCFGSEDESSSKAETEYSFDDWDWQNGSLSSLSLPESTREAKS
NLNNMSTTEEYLISKCVLDLKIMQTIMHENDDRLRNIEQILDEVEMKQKEQEERMSLWATSREFTNAYKLPLAVGPPSLN
YIPPVLQLSGGQKPDTSGNYPTLPRFPRMLPTLCDPGKQNTDEQFQCTQGAKDSLETSRIQNTSSQGRPRESTAQAKATQ
FNSALFTLSSHRQGPSASPSCHWDSTRMSVEPVSSEIYNAESRNKDDGKVHLKWKMEVKEMAKKAATGQLTVPPWHPQSS
LTLESEAENEPDALLQPPIRSPENTDWQRVIEYHRENDEPRGNGKFDKTGNNDCDSDQHGRQPRLGSFTSIRHPSPRQKE
QPEHSEAFQASSDTLVAVEKSYSHQSMQSTCSPESSEDITDEFLTPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFA
QPQVSGEEKFQMRKILGKNAEILPRSQFQPVRSTEDEQEETSKESPKELKEKDISLTDIQDLSSISYEPDSSFKEASCKT
PKINHAPTSVSTPLSPGSVSSAASQYKDCLESITFQVKTEFASCWNSQEFIQTLSDDFISVRERAKKLDSLLTSSETPPS
RLTGLKRLSSFIGAGSPSLVKACDSSPPHATQRRSLPKVEAFSQHHIDELPPPSQELLDDIELLKQQQGSSTVLHENTAS
DGGGTANDQRHLEEQETDSKKEDSSMPLSKETEDLGEDTERAHSTLDEDLERWLQPPEESVELQDLPKGSERETNIKDQK
VGEEKRKREDSITPERRKSEGVLGTSEEDELKSCFWKRLGWSESSRIIVLDQSDLSD