Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17277 TESK1 Homo sapiens No Kinases

HuProt v2.0
Block Row Column Clone
21 26 1 JHU17277
21 26 2 JHU17277
7 26 5 JHU17277
7 26 6 JHU17277
HuProt v3.0
Block Row Column Clone
24 1 21 JHU17277
24 2 21 JHU17277
23 1 10 JHU17277
23 2 10 JHU17277
HuProt v3.1
Block Row Column Clone
24 1 21 JHU17277
24 2 21 JHU17277
23 1 10 JHU17277
23 2 10 JHU17277

External Database ID

Nucleotide (1878bp)

>JHU17277
ATGGCCGGGGAACGGCCCCCACTGCGGGGCCCTGGGCCCGGGCCTGGAGAGGTGCCGGGGGAGGGGCCCCCGGGGCCGGG
GGGCACGGGCGGAGGCCCGGGCCGGGGCCGCCCCTCCTCCTACCGGGCTCTCCGCAGCGCCGTGTCTAGCCTGGCGCGTG
TGGACGATTTTCACTGCGCGGAGAAGATCGGGGCCGGCTTCTTCTCTGAGGTCTACAAGGTTCGGCACCGACAGTCAGGG
CAAGTCATGGTGCTGAAGATGAACAAGCTCCCCAGTAACCGGGGCAACACACTACGGGAAGTGCAGCTGATGAACCGGCT
CAGGCACCCCAACATCCTAAGGTTCATGGGAGTCTGTGTGCACCAGGGACAGCTGCACGCTCTTACAGAGTATATGAATG
GGGGGACATTGGAACAGCTGCTCAGCTCCCCTGAACCCCTATCCTGGCCGGTCAGGCTCCACCTGGCCCTGGACATTGCC
CGAGGCCTGCGGTACCTGCACTCCAAAGGTGTATTTCACCGCGACCTCACATCCAAGAACTGTCTAGTCCGACGGGAAGA
TCGAGGCTTCACCGCTGTCGTGGGTGACTTCGGGCTGGCCGAAAAGATTCCTGTGTATAGGGAGGGGGCAAGGAAGGAGC
CATTGGCCGTGGTGGGCTCCCCATACTGGATGGCTCCAGAGGTGTTACGGGGTGAGCTGTATGATGAGAAGGCTGATGTC
TTTGCCTTCGGGATTGTCCTCTGTGAGCTCATCGCCCGAGTACCTGCAGACCCTGACTACCTACCACGCACTGAGGACTT
TGGCCTGGATGTGCCTGCTTTCCGAACTCTGGTGGGGGATGACTGCCCACTGCCTTTCTTGCTCCTGGCCATCCACTGCT
GCAACCTGGAACCCAGCACCCGTGCCCCCTTCACCGAAATTACCCAGCACCTGGAATGGATCCTGGAGCAGCTGCCTGAG
CCAGCCCCACTCACCAGGACCGCCCTGACACACAATCAGGGCTCTGTTGCAAGAGGGGGTCCCTCTGCCACGCTTCCCAG
GCCAGATCCCCGGCTTTCCCGAAGCCGGTCAGACCTCTTCCTGCCCCCATCACCAGAATCACCCCCCAACTGGGGGGACA
ATCTGACTCGAGTCAACCCCTTCTCACTACGGGAAGACCTCAGGGGTGGCAAGATCAAGCTCTTAGACACACCCAGCAAG
CCAGTCCTGCCTCTTGTGCCACCATCACCATTCCCATCCACTCAGCTGCCCTTGGTGACCACTCCGGAGACCCTGGTCCA
GCCTGGGACACCTGCCCGCCGCTGCCGCTCACTACCCTCATCCCCCGAGCTCCCCCGCCGTATGGAGACAGCACTGCCAG
GTCCTGGCCCTCCCGCTGTGGGCCCCTCGGCTGAAGAGAAGATGGAGTGCGAGGGCAGCAGCCCTGAGCCGGAACCTCCA
GGGCCAGCGCCCCAGCTGCCTCTGGCTGTGGCCACAGACAACTTCATCAGCACCTGTTCCTCGGCCTCCCAACCCTGGTC
CCCTAGATCAGGACCCGTCCTCAATAACAATCCCCCAGCTGTGGTGGTGAACTCCCCACAAGGCTGGGCTGGGGAGCCCT
GGAACCGGGCCCAGCATAGCCTGCCCCGGGCGGCAGCCCTGGAGCGGACAGAACCCTCGCCACCCCCTTCAGCTCCCCGG
GAGCCCGATGAGGGGCTGCCCTGTCCTGGCTGCTGCCTCGGCCCCTTCAGCTTTGGCTTCCTGTCCATGTGCCCCCGCCC
CACACCAGCTGTTGCCCGCTACCGCAACCTGAACTGTGAGGCGGGCAGTCTCCTCTGCCACCGAGGGCACCACGCCAAGC
CACCCACACCCAGCCTGCAGCTGCCTGGGGCACGCTCT

Protein (626aa)

>JHU17277
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSG
QVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIA
RGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPE
PAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSK
PVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPR
EPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS