Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17272 PDK1 PDHK1 Homo sapiens No Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
47 26 1 JHU17272
47 26 2 JHU17272
37 26 3 JHU17272
37 26 4 JHU17272
13 26 1 JHU17272
13 26 2 JHU17272
5 26 3 JHU17272
5 26 4 JHU17272
29 26 5 JHU17272
29 26 6 JHU17272
5 26 7 JHU17272
5 26 8 JHU17272
42 27 15 JHU17272
42 27 16 JHU17272
HuProt v3.0
Block Row Column Clone
24 3 30 JHU17272
24 4 30 JHU17272
24 5 21 JHU17272
24 6 21 JHU17272
24 1 13 JHU17272
24 2 13 JHU17272
24 3 21 JHU17272
24 4 21 JHU17272
23 1 31 JHU17272
23 2 31 JHU17272
23 3 21 JHU17272
23 4 21 JHU17272
21 17 23 JHU17272
21 18 23 JHU17272
HuProt v3.1
Block Row Column Clone
24 3 30 JHU17272
24 4 30 JHU17272
24 5 21 JHU17272
24 6 21 JHU17272
24 1 13 JHU17272
24 2 13 JHU17272
24 3 21 JHU17272
24 4 21 JHU17272
23 1 31 JHU17272
23 2 31 JHU17272
23 3 21 JHU17272
23 4 21 JHU17272
21 17 23 JHU17272
21 18 23 JHU17272
22 47 17 JHU17272
22 48 17 JHU17272

External Database ID

Nucleotide (1308bp)

>JHU17272
ATGAGGCTGGCGCGGCTGCTTCGCGGAGCCGCCTTGGCCGGCCCGGGCCCGGGGCTGCGCGCCGCCGGCTTCAGCCGCAG
CTTCAGCTCGGACTCGGGCTCCAGCCCGGCGTCCGAGCGCGGCGTTCCGGGCCAGGTGGACTTCTACGCGCGCTTCTCGC
CGTCCCCGCTCTCCATGAAGCAGTTCCTGGACTTCGGATCAGTGAATGCTTGTGAAAAGACCTCATTTATGTTTCTGCGG
CAAGAGTTGCCTGTCAGACTGGCAAATATAATGAAAGAAATAAGTCTCCTTCCAGATAATCTTCTCAGGACACCATCCGT
TCAATTGGTACAAAGCTGGTATATCCAGAGTCTTCAGGAGCTTCTTGATTTTAAGGACAAAAGTGCTGAGGATGCTAAAG
CTATTTATGACTTTACAGATACTGTGATACGGATCAGAAACCGACACAATGATGTCATTCCCACAATGGCCCAGGGTGTG
ATTGAATACAAGGAGAGCTTTGGGGTGGATCCTGTCACCAGCCAGAATGTTCAGTACTTTTTGGATCGATTCTACATGAG
TCGCATTTCAATTAGAATGTTACTCAATCAGCACTCTTTATTGTTTGGTGGAAAAGGCAAAGGAAGTCCATCTCATCGAA
AACACATTGGAAGCATAAATCCAAACTGCAATGTACTTGAAGTTATTAAAGATGGCTATGAAAATGCTAGGCGTCTGTGT
GATTTGTATTATATTAACTCTCCCGAACTAGAACTTGAAGAACTAAATGCAAAATCACCAGGACAGCCAATACAAGTGGT
TTATGTACCATCCCATCTCTATCACATGGTGTTTGAACTTTTCAAGAATGCAATGAGAGCCACTATGGAACACCATGCCA
ACAGAGGTGTTTACCCCCCTATTCAAGTTCATGTCACGCTGGGTAATGAGGATTTGACTGTGAAGATGAGTGACCGAGGA
GGTGGCGTTCCTTTGAGGAAAATTGACAGACTTTTCAACTACATGTATTCAACTGCACCAAGACCTCGTGTTGAGACCTC
CCGCGCAGTGCCTCTGGCTGGTTTTGGTTATGGATTGCCCATATCACGTCTTTACGCACAATACTTCCAAGGAGACCTGA
AGCTGTATTCCCTAGAGGGTTACGGGACAGATGCAGTTATCTACATTAAGGCTCTGTCAACAGACTCAATAGAAAGACTC
CCAGTGTATAACAAAGCTGCCTGGAAGCATTACAACACCAACCACGAGGCTGATGACTGGTGCGTCCCCAGCAGAGAACC
CAAAGACATGACGACGTTCCGCAGTGCC

Protein (436aa)

>JHU17272
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLR
QELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGV
IEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRG
GGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA