Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17259 ACTR2 ARP2 Homo sapiens No Signal Transduction

HuProt v2.0
Block Row Column Clone
15 26 5 JHU17259
15 26 6 JHU17259
HuProt v3.0
Block Row Column Clone
23 1 30 JHU17259
23 2 30 JHU17259
HuProt v3.1
Block Row Column Clone
23 1 30 JHU17259
23 2 30 JHU17259
23 57 11 JHU17259
23 58 11 JHU17259

External Database ID

Nucleotide (1182bp)

>JHU17259
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGGTTTGTGAAGTGTGGATATGCAGGCTCTAACTT
TCCAGAACACATCTTCCCAGCTTTGGTTGGAAGACCTATTATCAGATCAACCACCAAAGTGGGAAACATTGAAATCAAGG
ATCTTATGGTTGGTGATGAGGCAAGTGAATTACGATCAACGTTAGAAGTTAACTACCCTATGGAAAATGGCATAGTACGA
AATTGGGATGACATGAAACACCTGTGGGACTACACATTTGGACCAGAGAAACTTAATATAGATACCAGAAATTGTAAAAT
CTTACTCACAGAACCTCCTATGAACCCAACCAAAAACAGAGAGAAGATTGTAGAGGTAATGTTTGAAACTTACCAGTTTT
CCGGTGTATATGTAGCCATCCAGGCAGTTCTGACTTTGTACGCTCAAGGTTTATTGACTGGTGTAGTGGTAGACTCTGGA
GATGGTGTGACTCACATTTGCCCAGTATATGAAAGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAG
GGATATAACTAGATATCTTATCAAGCTACTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTC
GCATGATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCCTTAGAAACCACAGTATTA
GTTGAATCTTATACACTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCTTTATTTCA
GCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACAATTCAGGCAGCTGACATTGATACCA
GATCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCCATCACGGTTGGAACGAGAA
CTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGTGGAAAAACTTTCTAAATTTAAGATCCGCATTGAAGACCC
ACCCCGCAGAAAGCACATGGTATTCCTGGGTGGTGCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGA
CCCGACAAGAGTACCAAGAAAAAGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGA

Protein (394aa)

>JHU17259
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTLEVNYPMENGIVR
NWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSG
DGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERE
LKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR