Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17238 QSOX1 QSCN6 Homo sapiens No Kinases; Secreted Proteins

HuProt v2.0
Block Row Column Clone
11 26 5 JHU17238
11 26 6 JHU17238
9 26 5 JHU17238
9 26 6 JHU17238
HuProt v3.0
Block Row Column Clone
23 1 16 JHU17238
23 2 16 JHU17238
23 1 11 JHU17238
23 2 11 JHU17238
HuProt v3.1
Block Row Column Clone
23 1 16 JHU17238
23 2 16 JHU17238
23 1 11 JHU17238
23 2 11 JHU17238

External Database ID

Nucleotide (1812bp)

>JHU17238
ATGAGGAGGTGCAACAGCGGCTCCGGGCCGCCGCCGTCGCTGCTGCTGCTGCTGCTGTGGCTGCTCGCGGTTCCCGGCGC
TAACGCGGCCCCGCGGTCGGCGCTCTATTCGCCTTCCGACCCGCTGACGCTGCTGCAGGCGGACACGGTGCGCGGCGCGG
TGCTGGGCTCCCGCAGCGCCTGGGCCGTGGAGTTCTTCGCCTCCTGGTGCGGCCACTGCATCGCCTTCGCCCCGACGTGG
AAGGCGCTGGCCGAAGACGTCAAAGCCTGGAGGCCGGCCCTGTATCTCGCCGCCCTGGACTGTGCTGAGGAGACCAACAG
TGCAGTCTGCAGAGACTTCAACATCCCTGGCTTCCCGACTGTGAGGTTCTTCAAGGCCTTTACCAAGAACGGCTCAGGAG
CAGTATTTCCAGTGGCTGGTGCTGACGTGCAGACGCTGCGGGAGAGGCTCATTGACGCCCTGGAGTCCCATCATGACACG
TGGCCCCCAGCCTGTCCCCCACTGGAGCCTGCCAAGCTGGAGGAGATTGATGGATTCTTTGCGAGAAATAACGAAGAGTA
CCTGGCTCTGATCTTTGAAAAGGGAGGCTCCTACCTGGCTAGAGAGGTGGCTCTGGACCTGTCCCAGCACAAAGGCGTGG
CGGTGCGCAGGGTGCTGAACACAGAGGCCAATGTGGTGAGAAAGTTTGGTGTCACCGACTTCCCCTCTTGCTACCTGCTG
TTCCGGAATGGCTCTGTCTCCCGAGTCCCCGTGCTCATGGAATCCAGGTCCTTCTATACCGCTTACCTGCAGAGACTCTC
TGGGCTCACCAGGGAGGCTGCCCAGACCACAGTTGCACCAACCACTGCTAACAAGATAGCTCCCACTGTTTGGAAATTGG
CAGATCGCTCCAAGATCTACATGGCTGACCTGGAATCTGCACTGCACTACATCCTGCGGATAGAAGTGGGCAGGTTCCCG
GTCCTGGAAGGGCAGCGCCTGGTGGCCCTGAAAAAGTTTGTGGCAGTGCTGGCCAAGTATTTCCCTGGCCGGCCCTTAGT
CCAGAACTTCCTGCACTCCGTGAATGAATGGCTCAAGAGGCAGAAGAGAAATAAAATTCCCTACAGTTTCTTTAAAACTG
CCCTGGACGACAGGAAAGAGGGTGCCGTTCTTGCCAAGAAGGTGAACTGGATTGGCTGCCAGGGGAGTGAGCCGCATTTC
CGGGGCTTTCCCTGCTCCCTGTGGGTTCTTTTCCACTTCTTGACTGTGCAGGCAGCTCGGCAAAATGTAGACCACTCACA
GGAAGCAGCCAAGGCCAAGGAGGTCCTCCCAGCCATCCGAGGCTACGTGCACTACTTCTTCGGCTGCCGAGACTGCGCTA
GCCACTTCGAGCAGATGGCTGCTGCCTCCATGCACCGGGTGGGGAGTCCCAACGCCGCTGTCCTCTGGCTCTGGTCTAGC
CACAACAGGGTCAATGCTCGCCTTGCAGGTGCCCCCAGCGAGGACCCCCAGTTCCCCAAGGTGCAGTGGCCACCCCGTGA
ACTTTGTTCTGCCTGCCACAATGAACGCCTGGATGTGCCCGTGTGGGACGTGGAAGCCACCCTCAACTTCCTCAAGGCCC
ACTTCTCCCCAAGCAACATCATCCTGGACTTCCCTGCAGCTGGGTCAGCTGCCCGGAGGGATGTGCAGAATGTGGCAGCC
GCCCCAGAGCTGGCGATGGGAGCCCTGGAGCTGGAAAGCCGGAATTCAACTCTGGACCCTGGGAAGCCTGAGATGATGAA
GTCCCCCACAAACACCACCCCACATGTGCCGGCTGAGGGACCTGAGCTTATT

Protein (604aa)

>JHU17238
MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTW
KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDT
WPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLAREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLL
FRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFP
VLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHF
RGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSS
HNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAA
APELAMGALELESRNSTLDPGKPEMMKSPTNTTPHVPAEGPELI