Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17205 ZMIZ2_frag Homo sapiens No Nuclear Proteins

HuProt v2.0
Block Row Column Clone
24 26 13 JHU17205
24 26 14 JHU17205
HuProt v3.0
Block Row Column Clone
21 1 22 JHU17205
21 2 22 JHU17205
HuProt v3.1
Block Row Column Clone
21 1 22 JHU17205
21 2 22 JHU17205

Nucleotide (1326bp)

>JHU17205
ATGAACACCAACTGGCCAGCCTCGGTGCAGGTCAGCGTCAATGCCACGCCGCTCACCATCGAGCGTGGCGACAACAAGAC
CTCGCACAAGCCACTCTACCTGAAGCATGTGTGCCAGCCAGGCCGCAACACCATCCAGATCACCGTCACCGCCTGCTGCT
GCTCCCACCTCTTCGTGCTGCAGCTAGTGCACCGCCCATCCGTCCGCTCGGTGCTGCAGGGCCTCCTCAAAAAGCGCCTC
CTGCCTGCTGAGCACTGCATCACCAAGATAAAGCGGAACTTCAGCAGCGGCACCATCCCTGGCACCCCTGGGCCCAACGG
AGAGGACGGGGTGGAGCAGACAGCTATCAAGGTGTCCCTGAAGTGCCCCATCACCTTCCGCAGGATCCAGCTCCCTGCCC
GAGGTCATGACTGTCGCCACATACAGTGCTTTGACCTGGAGTCGTACCTGCAGCTCAACTGTGAGCGGGGGACTTGGAGG
TGTCCTGTGTGCAACAAGACAGCTTTGCTGGAGGGCCTGGAGGTGGACCAGTACATGCTGGGCATCCTGATTTACATTCA
GAACTCTGACTATGAGGAGATCACCATCGACCCCACGTGCAGCTGGAAGCCAGTGCCCGTGAAGCCTGACATGCACATCA
AGGAGGAGCCGGATGGGCCAGCACTGAAGCGCTGCCGCACCGTGAGCCCCGCCCACGTGCTCATGCCCAGCGTGATGGAG
ATGATCGCCGCCCTGGGCCCCGGCGCTGCCCCCTTTGCCCCCCTGCAGCCCCCCTCAGTCCCTGCCCCCAGCGACTACCC
TGGCCAGGGTTCCAGCTTCCTGGGGCCTGGAACTTTCCCTGAGTCCTTCCCACCCACCACGCCCAGCACCCCAACCCTTG
CTGAGTTCACCCCGGGACCACCCCCCATCTCCTACCAGTCTGACATTCCCAGCAGCCTCCTGACTTCAGAGAAGTCTACC
GCCTGCCTCCCAAGCCAGATGGCACCAGCAGGTCACCTGGACCCCACTCACAATCCTGGGACACCAGGACTACACACCTC
CAACCTTGGGGCCCCTCCAGGTCCCCAGCTGCACCATTCAAACCCTCCCCCAGCGTCCCGGCAGTCCTTGGGCCAAGCGA
GCTTAGGACCTACGGGTGAACTGGCCTTCAGTCCTGCCACAGGCGTGATGGGGCCCCCCAGCATGTCTGGAGCCGGGGAG
GCCCCAGAACCAGCTCTGGACCTGCTCCCGGAACTGACCAACCCTGATGAGCTACTGTCCTACTTGGGCCCACCCGACCT
CCCTACGAACAACAATGACGACCTGCTTTCTCTGTTTGAGAACAAC

Protein (442aa)

>JHU17205
MNTNWPASVQVSVNATPLTIERGDNKTSHKPLYLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRL
LPAEHCITKIKRNFSSGTIPGTPGPNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCRHIQCFDLESYLQLNCERGTWR
CPVCNKTALLEGLEVDQYMLGILIYIQNSDYEEITIDPTCSWKPVPVKPDMHIKEEPDGPALKRCRTVSPAHVLMPSVME
MIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIPSSLLTSEKST
ACLPSQMAPAGHLDPTHNPGTPGLHTSNLGAPPGPQLHHSNPPPASRQSLGQASLGPTGELAFSPATGVMGPPSMSGAGE
APEPALDLLPELTNPDELLSYLGPPDLPTNNNDDLLSLFENN