Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17200 VEPH1 KIAA1692;VEPH Homo sapiens No Membrane Proteins

HuProt v2.0
Block Row Column Clone
32 26 5 JHU17200
32 26 6 JHU17200
HuProt v3.0
Block Row Column Clone
23 1 32 JHU17200
23 2 32 JHU17200
HuProt v3.1
Block Row Column Clone
23 1 32 JHU17200
23 2 32 JHU17200

External Database ID

Nucleotide (2499bp)

>JHU17200
ATGCATCAACTGTTCAGACTGGTTTTGGGACAAAAAGATCTTTCACGAGCTGGGGACCTCTTCTCCTTAGATGACTCTGA
GATTGAAGACAGCCTTACAGAAGCTTTGGAGCAAATTAAGATAATTAGCTCATCTTCAGATTACCAAACCAATAACAATG
ACCAGGCAGTAGTTGAAATCTGTATCACAAGAATCACAACAGCCATCAGAGAGACCGAGTCCATTGAAAAGCATGCAAAG
GCCCTTGTGGGGCTCTGGGACTCCTGCTTGGAACATAACCTGAGACCCTTTGGGAAAGACGAAGACACTCCTCATGCAAA
AATCGCATCTGATATCATGAGTTGCATTTTACAGAATTACAACCGACCCCCAGTGATGGCATTAGCCATCCCCATTGCAG
TGAAATTCCTCCACAGAGGCAACAAGGAACTGTGCAGGAATATGTCTAACTACCTGTCTCTGGCTGCAATTACCAAGGCA
GATCTCCTGGCTGATCACACGGAAGTTATAGTAAAGAGCATACTCCAAGGTAACACCATGTTGTTGAGAGTGTTACCTGC
TGTGTATGAAAAGCAGCCTCAGCCAATTAATAGACACCTGACAGAACTCCTGGCCTTGATGTCTCAGCTGGAACAGCCAG
AACAGTACCATCTACTACGGCTTTTGCATGTAGCAGCAAAGAAAAAACAACTCGAGGTAGTTCAGAAGTGTATTCCTTTC
CTAATTGGGCATTTGAAGGATTCAACCCATAATGACATCATCCTAAACATCCTCATAGAGATAGCAGTCTATGAGCCAGT
GGCTTTGAACAGTTTTCTTCCAATGCTGAAAGAGATTGGTGAGAGATTCCCCTACCTCACTGGACAGATGGCAAGGATTT
ATGGAGCTGTTGGGCATGTGGATGAAGAGAGAGCCAGGAGCTGCCTGACATACCTGGTGAGCCAACTGGCCAACATGGAG
CATTCGTTTCACCATATTCTCCTGCTGGAGATTAAAAGCATCACCGACACCTTCTCCTCAATCTTGGGCCCTCAGAGCAG
AGACATCTTCCGCATGAGCAACAGCTTCACCGCCATTGCTAAACTCCTTACCCGACAACTGGAAAATACCAAGGCTGGAA
GTGGCAGGAGAAAAATCAGCACTGAAATTGAATTCCCTGAGAAACTGGAAGAAACCAAGCTCATAGTAACTGAAAATGAA
GACCATGAAAAACTCCAAGTTAAAATCCAGGCTTTTGAAGACAAGATAAATGCAGGGAGCAATACCCCTGGCTCTATCAG
AAGATATAGTCTGGGCCAAGTTTCTAAAGAAGAAAGAAAAAACATTAGATTTAACAGGTCAAAAAGTTTGGCTTTCCACA
CTATGCTCACAAAGGGTGTGGGTTCAGATGACGGCGAAGATGAAAACAGGGGAGACATACCAGCCAGCATCTCTCTTTCA
GAAATAGACCCACTTGGCCAAGGAAATGACAAGCTGCCGTTTAAGACAGACACTGAGAGATCACAGCTGGGGGAGTCTTC
AGTTTCATACCCAAATATTATACATATAGACTCAGAGAATTTGTCAGAAACTGTTAAAGAAAACTCCCAGGAAGAAACTC
CAGAGACAACTGCAAGTCCTATAGAATACCAAGATAAGCTCTACTTGCACTTAAAAAAAAACCTCAGCAAAGTGAAAGCA
TATGCCATGGAAATTGGAAAGAAGATTCCAGTCCCTGATCAGTGTACCATTGAAGACACTGTGAGAAGTTGTGTAGCAAA
GTTGTTCTTCACCTGCTCCCTGAAGGGTCATTACTGCCTATACAGTAAGTCCAGTTTTATTCTCATCAGCCAAGAACCTC
AGCCATGGATCCAGATCATGTTTCTATTTCAGCAGAGCCTGTTTCCTGAACCCCTGTCCATTCAGAGTCATTCTGTGCAA
TTCCTCAGAGCTCTGTGGGAGAAGACCCAGGCAGGGGGTGCTCACAGCTTTGAAACTGCCATGATGGAGTCCACGTTTCC
ACAGCAGAAGGATCTGGACCAGGTACAGCTCCATCTGGAAGAAGTGAGGTTCTTTGACGTGTTTGGCTTCAGTGAAACAG
CAGGAGCATGGCAATGCTTCATGTGCAACAATCCTGAGAAAGCAACTGTTGTAAATCAAGATGGCCAGCCTCTCATAGAA
GGAAAACTTAAAGAGAAGCAAGTCAGATGGAAGTTCATCAAAAGGTGGAAAACACGCTATTTTACACTGGCTGGAAATCA
ACTTCTGTTTCAAAAAGGAAAGTCTAAAGATGACCCTGACGACTGCCCAATAGAACTCAGCAAAGTACAGAGTGTGAAGG
CTGTGGCCAAGAAACGCAGGGACCGCTCTCTCCCCCGGGCTTTCGAAATCTTCACAGACAATAAAACCTATGTCTTTAAG
GCCAAGGATGAGAAGAATGCAGAAGAATGGCTCCAGTGCATCAACGTGGCAGTTGCCCAAGCCAAAGAAAGGGAAAGTAG
AGAAGTAACCACATATCTG

Protein (833aa)

>JHU17200
MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIRETESIEKHAK
ALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRGNKELCRNMSNYLSLAAITKA
DLLADHTEVIVKSILQGNTMLLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLRLLHVAAKKKQLEVVQKCIPF
LIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIGERFPYLTGQMARIYGAVGHVDEERARSCLTYLVSQLANME
HSFHHILLLEIKSITDTFSSILGPQSRDIFRMSNSFTAIAKLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENE
DHEKLQVKIQAFEDKINAGSNTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLS
EIDPLGQGNDKLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASPIEYQDKLYLHLKKNLSKVKA
YAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCLYSKSSFILISQEPQPWIQIMFLFQQSLFPEPLSIQSHSVQ
FLRALWEKTQAGGAHSFETAMMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLIE
GKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQSVKAVAKKRRDRSLPRAFEIFTDNKTYVFK
AKDEKNAEEWLQCINVAVAQAKERESREVTTYL