Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17197 STIL SIL Homo sapiens No Kinases; Transcription Factors

HuProt v2.0
Block Row Column Clone
6 26 5 JHU17197
6 26 6 JHU17197
HuProt v3.0
Block Row Column Clone
23 1 9 JHU17197
23 2 9 JHU17197
HuProt v3.1
Block Row Column Clone
23 1 9 JHU17197
23 2 9 JHU17197

External Database ID

Nucleotide (3861bp)

>JHU17197
ATGGAGCCTATATATCCTTTTGCACGGCCCCAGATGAATACCAGGTTTCCTTCAAGCAGGATGGTACCTTTCCACTTTCC
TCCATCAAAATGTGCACTTTGGAACCCAACGCCAACTGGAGATTTCATCTACTTACATCTCAGTTACTACAGAAATCCAA
AGCTTGTGGTGACTGAGAAGACCATCCGACTTGCTTATCGTCATGCTAAGCAGAATAAAAAAAATTCGTCATGCTTTTTA
CTTGGTTCTCTGACAGCAGACGAAGATGAAGAAGGTGTAACATTGACAGTAGATCGCTTTGATCCTGGTCGAGAAGTACC
TGAATGCCTAGAAATAACCCCTACTGCTTCTCTTCCTGGGGACTTTTTGATTCCATGCAAAGTTCATACTCAAGAACTTT
GTTCAAGAGAAATGATAGTTCACAGTGTAGATGACTTCAGTTCAGCTTTAAAGGCTCTACAGTGCCATATATGTAGCAAA
GATTCCTTGGACTGTGGTAAGCTGCTTTCCCTAAGAGTTCATATCACTTCCAGGGAGAGTTTGGACAGTGTGGAATTTGA
CTTGCATTGGGCAGCAGTAACTCTAGCAAATAACTTTAAATGCACACCTGTGAAGCCCATCCCCATTATTCCAACAGCTC
TGGCAAGAAACTTGAGCAGTAATCTGAATATTTCTCAAGTTCAAGGGACTTATAAATATGGATATCTTACCATGGATGAA
ACACGCAAATTGTTACTTTTGTTGGAATCTGATCCCAAGGTTTATTCTCTACCATTGGTGGGAATTTGGCTGTCTGGAAT
TACACATATCTATAGTCCTCAGGTATGGGCTTGCTGTTTGCGATACATATTCAATTCTTCTGTTCAAGAAAGGGTTTTTT
CAGAATCTGGAAATTTCATCATAGTTCTCTATTCTATGACACATAAGGAACCTGAGTTTTATGAATGCTTCCCTTGTGAT
GGCAAGATACCTGACTTTCGGTTTCAGTTGCTAACCAGTAAGGAAACATTACATCTTTTCAAAAATGTTGAACCTCCTGA
CAAAAATCCAATCCGTTGTGAACTGAGCGCTGAAAGCCAAAATGCAGAAACAGAGTTTTTCAGTAAGGCTTCCAAGAATT
TTTCAATTAAGAGGTCTTCCCAAAAGTTATCTTCTGGGAAGATGCCAATACATGATCACGACTCTGGTGTTGAAGATGAA
GATTTTTCTCCAAGACCAATTCCTAGTCCTCATCCAGTGAGTCAGAAGATTTCTAAGATCCAACCATCAGTTCCTGAACT
TTCACTTGTGTTGGATGGCAATTTCATAGAATCAAACCCTCTGCCTACTCCATTGGAAATGGTGAATAATGAAAATCCTC
CTTTGATTAACCACTTGGAACACTTGAAGCCATTGCAACCCCAGCTTTATGATGAGAAACACAGTCCAGAAGTTGAAGCT
GGAGAGCCTTCCTTGAGAGGAATACCAAATCAGTTAAACCAGGATAAACCAGCTCTTTTGAGACACTGCAAAGTAAGACA
GCCACCTGCCTATAAGAAAGGGAACCCCCATACCAGGAACAGTATTAAACCATCTTCTCATAATGGGCCATCTCATGATA
TATTTGAAAAGCTCCAAACAGTTTCTGCTGGAAATGTACAAAACGAAGAGTATCCTATAAGACCCTCCACACTTAATTCT
AGGCAGTCTTCTCTTGCCCCGCAGTCCCAACCACACGATTTTGTTTTTTCACCCCATAATTCAGGAAGACCAATGGAACT
TCAGATACCTACTCCCCCACTGCCATCTTACTGTTCCACAAACGTTTGCAGGTGTTGTCAGCATCATAGTCATATTCAAT
ATAGTCCGCTAAATTCTTGGCAAGGAGCAAACACAGTTGGATCCATTCAAGATGTCCAGTCTGAAGCCCTTCAAAAGCAT
TCATTATTTCACCCAAGTGGATGTCCAGCCCTGTACTGTAATGCATTCTGTTCTTCAAGTAGTCCTATAGCCTTGAGACC
TCAGGGAGATATGGGCAGTTGTTCTCCCCACAGCAATATTGAACCATCGCCTGTGGCAAGACCGCCTTCACATATGGACT
TATGTAACCCACAGCCTTGCACAGTGTGCATGCACACACCCAAGACTGAGTCAGATAATGGAATGATGGGACTATCTCCA
GATGCATATCGGTTCCTCACAGAACAAGACAGACAGCTAAGACTACTTCAGGCACAGATTCAGCGTTTGTTGGAAGCACA
GTCTCTGATGCCCTGTTCCCCTAAGACAACTGCTGTTGAAGACACAGTGCAAGCTGGAAGACAAATGGAGTTGGTTTCTG
TGGAAGCACAGTCTTCCCCTGGCTTGCACATGAGAAAAGGTGTAAGCATTGCTGTGAGCACAGGTGCTAGCTTGTTTTGG
AATGCAGCAGGTGAGGATCAAGAGCCTGACTCTCAAATGAAGCAAGATGATACCAAAATTTCCAGTGAGGACATGAATTT
TTCTGTCGATATTAATAATGAAGTCACAAGTCTTCCAGGTAGTGCATCTTCATTAAAAGCAGTTGATATTCCCAGTTTTG
AAGAGAGCAACATTGCTGTGGAAGAAGAATTTAACCAGCCACTTTCTGTATCCAACTCTTCTCTAGTTGTGAGAAAAGAA
CCTGATGTACCTGTGTTCTTTCCAAGTGGCCAGCTGGCAGAAAGTGTAAGCATGTGTTTACAGACTGGACCAACAGGGGG
TGCCAGTAACAATTCTGAAACATCAGAGGAACCAAAAATTGAGCATGTAATGCAACCCTTGCTTCATCAACCATCAGATA
ACCAGAAAATTTACCAGGATTTATTGGGTCAAGTAAACCACCTATTAAATAGTTCCTCCAAGGAAACTGAGCAGCCGTCT
ACCAAAGCAGTAATTATCAGTCATGAATGCACCAGAACCCAAAACGTTTACCATACAAAGAAAAAAACACATCATTCAAG
ACTGGTGGACAAAGATTGTGTCCTTAATGCAACTCTTAAGCAACTAAGAAGCCTTGGAGTAAAAATTGATTCTCCCACTA
AAGTGAAGAAAAATGCACATAACGTGGATCACGCCAGTGTGTTGGCATGCATCAGCCCAGAAGCAGTGATCTCTGGATTA
AACTGCATGTCATTTGCTAATGTTGGCATGAGCGGCTTAAGCCCCAATGGTGTGGATTTGAGCATGGAGGCAAATGCTAT
AGCTCTGAAATATTTAAATGAAAATCAGCTGTCACAACTGTCTGTCACTCGATCGAACCAAAATAATTGTGACCCATTCA
GCCTTCTCCATATTAATACAGACAGAAGCACAGTGGGGCTTAGTTTAATTTCACCAAACAACATGTCATTTGCAACCAAA
AAATATATGAAGAGATATGGACTCCTACAAAGCAGTGACAATAGTGAAGATGAAGAGGAACCTCCCGACAATGCAGATAG
CAAGAGTGAATATTTATTGAATCAGAACCTTAGGTCCATACCCGAACAGCTTGGTGGTCAGAAAGAGCCTTCTAAGAATG
ACCATGAAATAATTAATTGTTCTAACTGTGAATCTGTGGGGACCAACGCAGATACGCCAGTATTGAGAAATATTACAAAT
GAAGTTTTGCAGACAAAAGCAAAACAGCAGTTGACTGAAAAGCCAGCTTTCTTAGTAAAGAACCTTAAACCAAGTCCTGC
AGTGAACCTTCGAACCGGGAAAGCAGAGTTCACTCAACATCCTGAGAAAGAAAATGAAGGGGACATTACAATTTTTCCTG
AAAGTTTGCAACCTTCTGAAACGCTAAAGCAGATGAATAGCATGAATTCAGTAGGCACCTTCTTAGATGTAAAACGTCTC
AGACAGTTACCAAAATTATTT

Protein (1287aa)

>JHU17197
MEPIYPFARPQMNTRFPSSRMVPFHFPPSKCALWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNSSCFL
LGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELCSREMIVHSVDDFSSALKALQCHICSK
DSLDCGKLLSLRVHITSRESLDSVEFDLHWAAVTLANNFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDE
TRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEPEFYECFPCD
GKIPDFRFQLLTSKETLHLFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDE
DFSPRPIPSPHPVSQKISKIQPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEA
GEPSLRGIPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQTVSAGNVQNEEYPIRPSTLNS
RQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCSTNVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEALQKH
SLFHPSGCPALYCNAFCSSSSPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPCTVCMHTPKTESDNGMMGLSP
DAYRFLTEQDRQLRLLQAQIQRLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSPGLHMRKGVSIAVSTGASLFW
NAAGEDQEPDSQMKQDDTKISSEDMNFSVDINNEVTSLPGSASSLKAVDIPSFEESNIAVEEEFNQPLSVSNSSLVVRKE
PDVPVFFPSGQLAESVSMCLQTGPTGGASNNSETSEEPKIEHVMQPLLHQPSDNQKIYQDLLGQVNHLLNSSSKETEQPS
TKAVIISHECTRTQNVYHTKKKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNAHNVDHASVLACISPEAVISGL
NCMSFANVGMSGLSPNGVDLSMEANAIALKYLNENQLSQLSVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATK
KYMKRYGLLQSSDNSEDEEEPPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNITN
EVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRL
RQLPKLF