Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17194 SLC9A1 APNH1;NHE1 Homo sapiens No Cell Death; Membrane Proteins; Metabolism; Signal Transduction

HuProt v2.0
Block Row Column Clone
30 26 13 JHU17194
30 26 14 JHU17194
HuProt v3.0
Block Row Column Clone
21 1 27 JHU17194
21 2 27 JHU17194
HuProt v3.1
Block Row Column Clone
21 1 27 JHU17194
21 2 27 JHU17194

External Database ID

Nucleotide (1665bp)

>JHU17194
ATGGTTCTGCGGTCTGGCATCTGTGGCCTCTCTCCACATCGGATCTTCCCTTCCTTACTCGTGGTGGTTGCTTTGGTGGG
GCTGCTGCCTGTTCTCAGGAGCCATGGCCTCCAGCTCAGCCCAACTGCCAGCACCATTCGAAGCTCAGAGCCACCACGAG
AACGCTCGATTGGGGATGTCACCACCGCTCCACCGGAGGTCACCCCAGAGAGCCGCCCTGTTAATCATTCCGTCACTGAT
CATGGCATGAAGCCGCGCAAGGCCTTTCCAGTCCTGGGCATCGACTACACACACGTGCGCACCCCCTTCGAGATCTCCCT
CTGGATCCTTCTGGCCTGCCTCATGAAGATAGGTTTCCATGTGATCCCCACTATCTCAAGCATCGTCCCGGAGAGCTGCC
TGCTGATCGTGGTGGGGCTGCTGGTGGGGGGCCTGATCAAGGGTGTAGGCGAGACACCCCCCTTCCTGCAGTCCGACGTC
TTCTTCCTCTTCCTGCTGCCGCCCATCATCCTGGATGCGGGCTACTTCCTGCCACTGCGGCAGTTCACAGAAAACCTGGG
CACCATCCTGATCTTTGCCGTGGTGGGCACGCTGTGGAACGCCTTCTTCCTGGGCGGCCTCATGTACGCCGTGTGCCTGG
TGGGCGGTGAGCAGATCAACAACATCGGCCTCCTGGACAACCTGCTCTTCGGCAGCATCATCTCGGCCGTGGACCCCGTG
GCGGTTCTGGCTGTCTTTGAGGAAATTCACATCAATGAGCTGCTGCACATCCTTGTTTTTGGGGAGTCCTTGCTCAATGA
CGCCGTCACTGTGGTCCTGTATCACCTCTTTGAGGAGTTTGCCAACTACGAACACGTGGGCATCGTGGACATCTTCCTCG
GCTTCCTGAGCTTCTTCGTGGTGGCCCTGGGCGGGGTGCTTGTGGGCGTGGTCTACGGGGTCATCGCAGCCTTCACCTCC
CGATTTACCTCCCACATCCGGGTCATCGAGCCGCTCTTCGTCTTCCTCTACAGCTACATGGCCTACTTGTCAGCCGAGCT
CTTCCACCTGTCAGGCATCATGGCGCTCATAGCCTCAGGAGTGGTGATGCGCCCCTATGTGGAGGCCAACATCTCCCACA
AGTCCCACACCACCATCAAATACTTCCTGAAGATGTGGAGCAGCGTCAGCGAGACCCTCATCTTCATCTTCCTCGGCGTC
TCCACGGTGGCCGGCTCCCACCACTGGAACTGGACCTTCGTCATCAGCACCCTGCTCTTCTGCCTCATCGCCCGCGTGCT
GGGGGTGCTGGGCCTGACCTGGTTCATCAACAAGTTCCGTATCGTGAAGCTGACCCCCAAGGACCAGTTCATCATCGCCT
ATGGGGGCCTGCGAGGGGCCATCGCCTTCTCTCTGGGCTACCTCCTGGACAAGAAGCACTTCCCCATGTGTGACCTGTTC
CTCACTGCCATCATCACTGTCATCTTCTTCACCGTCTTTGTGCAGGTGCTGGGCCAGGGCAGGGCAGGCCCTTGCCTTGG
GGACCCTCACAGGCTGTTCCCGTGGAAAGAGAGGAAAGCGTGTGATTTGAAATGCGATTCTAGTCCCAGCTCCACCACTA
ACTTGCTGTGTGACCTTGGGCGAGCCACTCCCCCTTTCTGGGCCTCAGTTTCTTCAATCGTAAAG

Protein (555aa)

>JHU17194
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTD
HGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDV
FFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTS
RFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGV
STVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQVLGQGRAGPCLGDPHRLFPWKERKACDLKCDSSPSSTTNLLCDLGRATPPFWASVSSIVK