Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17184 PEX11G PEX11C Homo sapiens No

HuProt v2.0
Block Row Column Clone
32 26 13 JHU17184
32 26 14 JHU17184
HuProt v3.0
Block Row Column Clone
21 1 32 JHU17184
21 2 32 JHU17184
HuProt v3.1
Block Row Column Clone
21 1 32 JHU17184
21 2 32 JHU17184

External Database ID

Nucleotide (723bp)

>JHU17184
ATGGCGTCGCTGAGCGGCCTGGCGTCGGCGCTGGAGTCGTACAGGGGCCGGGACCGCCTGATCCGAGTGCTGGGGTACTG
CTGCCAGCTGGTTGGTGGAGTTCTGGTTGAACAGTGTCCCGCCAGGTCCGAAGTGGGGACACGTCTGTTGGTGGTGTCCA
CCCAACTCAGCCACTGCAGGACCATCTTGCGACTCTTTGATGACCTGGCCATGTTTGTCTACACTAAGCAATATGGCCTG
GGGGCACAGGAGGAGGACGCCTTTGTCCGCTGTGTCTCCGTCCTAGGGAACCTGGCTGACCAGCTCTACTACCCCTGTGA
GCACGTGGCCTGGGCGGCTGATGCCCGGGTCCTCCACGTGGACTCTTCTCGGTGGTGGACGCTGAGTACAACCCTGTGGG
CCCTCTCTCTGCTCCTGGGGGTTGCCAGGTCCCTGTGGATGCTGCTGAAACTGAGACAGAGGCTGCGGAGCCCCACGGCG
CCCTTCACCAGCCCGCTGCCCCGGGGCAAGCGGAGGGCCATGGAGGCGCAGATGCAGTCGGAGGCGCTGTCACTTCTCAG
CAACCTGGCCGACCTGGCCAACGCCGTGCACTGGCTGCCCCGGGGCGTGCTGTGGGCCGGCCGCTTCCCGCCGTGGCTAG
TGGGCCTCATGGGCACCATCTCCTCAATCCTCAGCATGTACCAGGCGGCCCGGGCCGGCGGCCAGGCCGAGGCCACTACC
CCC

Protein (241aa)

>JHU17184
MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGL
GAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTA
PFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATT
P