Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17165 LCA5L C21orf13 Homo sapiens No

HuProt v2.0
Block Row Column Clone
16 26 13 JHU17165
16 26 14 JHU17165
HuProt v3.0
Block Row Column Clone
21 1 14 JHU17165
21 2 14 JHU17165
HuProt v3.1
Block Row Column Clone
21 1 14 JHU17165
21 2 14 JHU17165

External Database ID

Nucleotide (2010bp)

>JHU17165
ATGTCTTTGGCTGATCTAACAAAAACAAATATAGATGAGCATTTCTTCGGCGTGGCATTAGAAAACAATAGGAGGTCTGC
AGCATGCAAGAGAAGCCCAGGCACAGGCGATTTTTCACGGAACAGTAATGCTTCCAATAAGAGTGTTGATTATAGCAGAT
CTCAGTGCTCCTGTGGAAGTTTAAGTTCTCAGTATGATTATTCAGAAGACTTTCTCTGTGATTGTTCAGAAAAGGCTATT
AATAGAAATTATTTAAAGCAGCCTGTGGTAAAAGAAAAGGAGAAGAAAAAGTATAATGTTTCTAAAATCTCCCAATCTAA
AGGCCAGAAGGAAATATCAGTTGAAAAAAAGCACACCTGGAATGCATCACTCTTTAATTCTCAAATCCATATGATTGCCC
AAAGAAGAGATGCTATGGCTCATCGAATACTCTCAGCAAGGCTTCATAAAATTAAAGGACTAAAAAATGAATTAGCTGAT
ATGCATCATAAATTGGAAGCCATCCTTACAGAAAACCAATTTTTGAAACAACTTCAGCTTAGGCATTTGAAAGCTATAGG
AAAATATGAGAATTCACAAAATAATCTACCTCAAATTATGGCTAAACATCAGAATGAAGTAAAAAATTTAAGGCAACTAC
TTAGGAAATCCCAGGAAAAGGAAAGAACTCTATCTAGGAAACTTAGAGAAACTGACAGCCAGTTACTGAAGACTAAAGAT
ATCTTGCAGGCACTGCAGAAACTTTCTGAAGACAAAAACCTTGCAGAAAGGGAAGAACTCACTCATAAATTATCTATTAT
CACAACAAAAATGGACGCAAATGACAAAAAAATACAGAGCTTGGAAAAACAACTGAGGTTGAACTGCAGAGCCTTTAGCC
GGCAGCTGGCTATTGAGACTCGGAAGACTTTAGCAGCTCAGACAGCTACCAAGACTCTGCAGGTGGAAGTAAAACACCTT
CAACAAAAACTTAAGGAAAAGGATCGTGAGCTTGAAATTAAAAACATCTATAGTCATCGAATACTTAAAAATTTACATGA
CACAGAGGACTATCCAAAAGTTTCTTCAACAAAATCAGTCCAAGCAGACAGAAAAATTTTGCCATTCACAAGTATGAGAC
ACCAGGGAACCCAAAAATCAGATGTTCCACCTTTGACAACTAAGGGTAAAAAGGCAACAGGAAACATCGATCATAAAGAA
AAATCAACTGAAATAAATCATGAAATTCCTCACTGTGTGAATAAACTACCAAAGCAAGAGGATTCTAAGAGAAAATATGA
AGATTTATCAGGGGAAGAGAAACATTTGGAAGTCCAAATACTGCTGGAGAATACTGGAAGACAAAAAGACAAAAAAGAAG
ACCAAGAAAAGAAAAACATTTTTGTGAAAGAAGAGCAAGAACTACCACCAAAAATAATTGAAGTTATTCATCCTGAAAGA
GAAAGCAATCAAGAAGATGTTCTAGTAAGAGAAAAGTTTAAAAGAAGCATGCAGAGAAATGGTGTGGATGACACACTTGG
CAAAGGCACTGCTCCCTACACGAAAGGCCCCCTCAGACAAAGAAGACATTACTCATTCACAGAAGCAACTGAAAACCTGC
ATCATGGGCTTCCTGCTTCAGGGGGGCCAGCCAATGCCGGCAACATGAGGTACAGTCATAGTACAGGCAAGCATCTCAGT
AACAGAGAGGAAATGGAGCTAGAGCATTCTGACAGTGGGTATGAGCCCTCATTTGGTAAGTCTTCCAGAATAAAAGTGAA
GGATACAACTTTCAGAGATAAGAAAAGCAGTCTCATGGAAGAACTCTTTGGATCAGGCTATGTCTTGAAAACTGACCAAT
CAAGTCCTGGTGTTGCAAAAGGCTCAGAGGAGCCTTTGCAAAGTAAGGAGTCGCATCCCCTGCCTCCCAGTCAGGCCTCC
ACCAGCCATGCTTTCGGAGACTCTAAAGTAACTGTGGTAAATTCTATTAAGCCATCGTCACCTACAGAAGGAAAAAGAAA
AATAATTATT

Protein (670aa)

>JHU17165
MSLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDYSRSQCSCGSLSSQYDYSEDFLCDCSEKAI
NRNYLKQPVVKEKEKKKYNVSKISQSKGQKEISVEKKHTWNASLFNSQIHMIAQRRDAMAHRILSARLHKIKGLKNELAD
MHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNNLPQIMAKHQNEVKNLRQLLRKSQEKERTLSRKLRETDSQLLKTKD
ILQALQKLSEDKNLAEREELTHKLSIITTKMDANDKKIQSLEKQLRLNCRAFSRQLAIETRKTLAAQTATKTLQVEVKHL
QQKLKEKDRELEIKNIYSHRILKNLHDTEDYPKVSSTKSVQADRKILPFTSMRHQGTQKSDVPPLTTKGKKATGNIDHKE
KSTEINHEIPHCVNKLPKQEDSKRKYEDLSGEEKHLEVQILLENTGRQKDKKEDQEKKNIFVKEEQELPPKIIEVIHPER
ESNQEDVLVREKFKRSMQRNGVDDTLGKGTAPYTKGPLRQRRHYSFTEATENLHHGLPASGGPANAGNMRYSHSTGKHLS
NREEMELEHSDSGYEPSFGKSSRIKVKDTTFRDKKSSLMEELFGSGYVLKTDQSSPGVAKGSEEPLQSKESHPLPPSQAS
TSHAFGDSKVTVVNSIKPSSPTEGKRKIII