Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17149 FYB Homo sapiens No Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
16 26 5 JHU17149
16 26 6 JHU17149
HuProt v3.0
Block Row Column Clone
23 1 14 JHU17149
23 2 14 JHU17149
HuProt v3.1
Block Row Column Clone
23 1 14 JHU17149
23 2 14 JHU17149
22 63 20 JHU17149
22 64 20 JHU17149

External Database ID

Nucleotide (2487bp)

>JHU17149
ATGGCGAAATATAACACGGGGGGCAACCCGACAGAGGATGTCTCAGTCAATAGCCGACCCTTCAGAGTCACAGGGCCAAA
CTCATCTTCAGGAATACAAGCAAGAAAGAACTTATTCAACAACCAAGGAAATGCCAGCCCTCCTGCAGGACCCAGCAATG
TACCTAAGTTTGGGTCCCCAAAGCCACCTGTGGCAGTCAAACCTTCTTCTGAGGAAAAGCCTGACAAGGAACCCAAGCCC
CCGTTTCTAAAGCCCACTGGAGCAGGCCAAAGATTCGGAACACCAGCCAGCTTGACCACCAGAGACCCCGAGGCGAAAGT
GGGATTTCTGAAACCTGTAGGCCCCAAGCCCATCAACTTGCCCAAAGAAGATTCCAAACCTACATTTCCCTGGCCTCCTG
GAAACAAGCCATCTCTTCACAGTGTAAACCAAGACCATGACTTAAAGCCACTAGGCCCGAAATCTGGGCCTACTCCTCCA
ACCTCAGAAAATGAACAGAAGCAAGCGTTTCCCAAATTGACTGGGGTTAAAGGGAAATTTATGTCAGCATCACAAGATCT
TGAACCCAAGCCCCTCTTCCCCAAACCCGCCTTTGGCCAGAAGCCGCCCCTAAGTACCGAGAACTCCCATGAAGACGAAA
GCCCCATGAAGAATGTGTCTTCATCAAAAGGGTCCCCAGCTCCCCTGGGAGTCAGGTCCAAAAGCGGCCCTTTAAAACCA
GCAAGGGAAGACTCAGAAAATAAAGACCATGCAGGGGAGATTTCAAGTTTGCCCTTTCCTGGAGTGGTTTTGAAACCTGC
TGCGAGCAGGGGAGGCCCAGGTCTCTCCAAAAATGGTGAAGAAAAAAAGGAAGATAGGAAGATAGATGCTGCTAAGAACA
CCTTCCAGAGCAAAATAAATCAGGAAGAGTTGGCCTCAGGGACTCCTCCTGCCAGGTTCCCTAAGGCCCCTTCTAAGCTG
ACAGTGGGGGGGCCATGGGGCCAAAGTCAGGAAAAGGAAAAGGGAGACAAGAATTCAGCCACCCCGAAACAGAAGCCATT
GCCTCCCTTGTTTACCTTGGGTCCACCTCCACCAAAACCCAACAGACCACCAAATGTTGACCTGACGAAATTCCACAAAA
CCTCTTCTGGAAACAGTACTAGCAAAGGCCAGACGTCTTACTCAACAACTTCCCTGCCACCACCTCCACCATCCCATCCG
GCCAGCCAACCACCATTGCCAGCATCTCACCCATCACAACCACCAGTCCCAAGCCTACCTCCCAGAAACATTAAACCTCC
GTTTGACCTAAAAAGCCCTGTCAATGAAGACAATCAAGATGGTGTCACGCACTCTGATGGTGCTGGAAATCTAGATGAGG
AACAAGACAGTGAAGGAGAAACATATGAAGACATAGAAGCATCCAAAGAAAGAGAGAAGAAAAGGGAAAAGGAAGAAAAG
AAGAGGTTAGAGCTGGAGAAAAAGGAACAGAAAGAGAAAGAAAAGAAAGAACAAGAAATAAAGAAGAAATTTAAACTAAC
AGGCCCTATTCAAGTCATCCATCTTGCAAAAGCTTGTTGTGATGTCAAAGGAGGAAAGAATGAACTGAGCTTCAAGCAAG
GAGAGCAAATTGAAATCATCCGCATCACAGACAACCCAGAAGGAAAATGGTTGGGCAGAACAGCAAGGGGTTCATATGGC
TATATTAAAACAACTGCTGTAGAGATTGACTATGATTCTTTGAAACTGAAAAAAGACTCTCTTGGTGCCCCTTCAAGACC
TATTGAAGATGACCAAGAAGTATATGATGATGTTGCAGAGCAGGATGATATTAGCAGCCACAGTCAGAGTGGAAGTGGAG
GGATATTCCCTCCACCACCAGATGATGACATTTATGATGGGATTGAAGAGGAAGATGCTGATGATGGCTCCACACTACAG
GTTCAAGAGAAGAGTAATACGTGGTCCTGGGGGATTTTGAAGATGTTAAAGGGAAAAGATGACAGAAAGAAAAGTATACG
AGAGAAACCTAAAGTCTCTGACTCAGACAATAATGAAGGTTCATCTTTCCCTGCTCCTCCTAAACAATTGGACATGGGAG
ATGAAGTTTACGATGATGTGGATACCTCTGATTTCCCTGTTTCATCAGCAGAGATGAGTCAAGGAACTAATTTTGGAAAA
GCTAAGACAGAAGAAAAGGACCTTAAGAAGCTAAAAAAGCAGGAAAAAGAAGAAAAAGACTTCAGGAAAAAATTTAAATA
TGATGGTGAAATTAGAGTCCTATATTCAACTAAAGTTACAACTTCCATAACTTCTAAAAAGTGGGGAACCAGAGATCTAC
AGGTAAAACCTGGTGAATCTCTAGAAGTTATACAAACCACAGATGACACAAAAGTTCTCTGCAGAAATGAAGAAGGGAAA
TATGGTTATGTCCTTCGGAGTTACCTAGCGGACAATGATGGAGAGATCTATGATGATATTGCTGATGGCTGCATCTATGA
CAATGAC

Protein (829aa)

>JHU17149
MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSSEEKPDKEPKP
PFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLHSVNQDHDLKPLGPKSGPTPP
TSENEQKQAFPKLTGVKGKFMSASQDLEPKPLFPKPAFGQKPPLSTENSHEDESPMKNVSSSKGSPAPLGVRSKSGPLKP
AREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKL
TVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGPPPPKPNRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHP
ASQPPLPASHPSQPPVPSLPPRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEK
KRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYG
YIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAEQDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGSTLQ
VQEKSNTWSWGILKMLKGKDDRKKSIREKPKVSDSDNNEGSSFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNFGK
AKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGK
YGYVLRSYLADNDGEIYDDIADGCIYDND