Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17147 FRMPD4 KIAA0316;PDZD10;PDZK10 Homo sapiens No

HuProt v2.0
Block Row Column Clone
14 26 5 JHU17147
14 26 6 JHU17147
HuProt v3.0
Block Row Column Clone
23 1 29 JHU17147
23 2 29 JHU17147
HuProt v3.1
Block Row Column Clone
23 1 29 JHU17147
23 2 29 JHU17147

External Database ID

Nucleotide (3966bp)

>JHU17147
ATGGATGTCTTCAGCTTTGTGAAGATTGCAAAGCTTTCGAGCCACAGGACGAAGTCTTCAGGCTGGCCGCCTCCCTCGGG
AACCTGGGGCTTGAGCCAGGTGCCGCCCTATGGATGGGAGATGACGGCAAACCGAGATGGGCGAGACTACTTCATCAATC
ACATGACACAGGCAATCCCTTTTGACGACCCTCGGTTAGAGAGCTGCCAAATCATCCCTCCGGCTCCTCGGAAGGTGGAG
ATGAGAAGGGACCCCGTGCTGGGATTTGGTTTTGTGGCAGGCAGTGAAAAGCCAGTGGTCGTTCGCTCAGTAACACCAGG
TGGCCCCTCTGAAGGCAAGCTGATCCCGGGAGATCAGATTGTAATGATTAATGATGAACCGGTCAGCGCTGCACCCAGAG
AGCGGGTCATCGATCTGGTCAGAAGCTGCAAAGAATCGATACTCCTCACTGTCATTCAGCCTTACCCTTCTCCCAAATCA
GCATTTATTAGTGCTGCAAAAAAGGCAAGATTAAAGTCCAATCCTGTCAAAGTACGCTTCTCTGAGGAGGTCATCATCAA
CGGCCAAGTGTCGGAAACTGTTAAGGACAACTCACTTCTTTTTATGCCAAATGTTTTGAAAGTCTATCTGGAAAATGGGC
AGACCAAATCATTTCGTTTTGACTGCAGCACTTCCATTAAGGATGTCATCTTAACCCTTCAAGAGAAGCTCTCCATCAAA
GGCATTGAACACTTCTCTCTCATGCTGGAGCAGAGGACAGAAGGGGCTGGAACGAAGCTGCTCTTGCTTCATGAACAGGA
GACTCTAACTCAGGTGACACAGAGGCCCAGCTCCCATAAGATGAGATGTCTTTTCCGAATTAGCTTCGTCCCAAAAGATC
CAATTGACCTTTTAAGGAGAGATCCAGTTGCTTTCGAGTATCTCTATGTTCAGAGTTGTAACGATGTGGTTCAGGAGCGA
TTTGGGCCGGAGCTGAAATATGACATAGCCCTGCGGCTGGCCGCATTACAAATGTACATTGCAACCGTTACCACCAAGCA
AACGCAGAAAATCTCCCTCAAATACATCGAAAAAGAATGGGGATTAGAGACTTTTCTTCCCTCTGCTGTGCTGCAAAGCA
TGAAAGAGAAGAACATAAAGAAAGCACTTTCACACCTTGTCAAAGCAAATCAAAACTTGGTACCACCGGGTAAAAAGCTC
TCTGCACTACAAGCCAAGGTCCATTATCTCAAGTTCCTCAGTGACCTACGATTGTATGGGGGCCGTGTGTTCAAGGCAAC
ATTAGTGCAGGCAGAAAAGCGCTCGGAAGTGACTCTCCTGGTTGGGCCCCGGTATGGCATAAGCCATGTCATCAACACCA
AAACCAATCTGGTGGCTCTTTTAGCCGACTTTAGCCACGTCAACAGGATCGAAATGTTTTCCGAGGAGGAGAGCTTGGTG
CGGGTAGAACTCCACGTGCTAGATGTGAAGCCTATCACGCTTCTGATGGAATCCTCAGATGCCATGAACCTGGCCTGCTT
GACGGCTGGATACTACCGGCTGCTTGTTGATTCCAGGAGGTCGATATTTAACATGGCCAACAAGAAAAACACAGCGACCC
AGGAAACAGGACCTGAAAACAAGGGGAAGCATAACCTCCTTGGCCCAGATTGGAACTGTATACCCCAAATGACCACCTTT
ATTGGCGAAGGGGAACAAGAAGCCCAGATAACATACATAGATTCAAAGCAGAAGACGGTGGAGATCACAGACAGCACCAT
GTGTCCAAAAGAGCACCGGCACTTGTACATAGACAATGCCTATAGTTCAGATGGACTTAACCAGCAGCTGAGCCAGCCCG
GGGAGGCCCCCTGTGAGGCAGACTACAGAAGTCTAGCTCAGCGGTCCCTATTGACCCTCTCAGGACCAGAAACTCTGAAG
AAAGCACAGGAATCTCCGAGAGGAGCTAAAGTGTCCTTTATTTTTGGAGACTTCGCCTTGGATGATGGTATTAGTCCCCC
AACCCTTGGCTATGAAACGCTACTAGATGAGGGTCCTGAAATGCTGGAGAAGCAGAGAAATCTCTACATTGGCAGTGCCA
ATGACATGAAGGGCCTGGATCTCACTCCAGAGGCAGAGGGCATCCAGTTTGTGGAAAATTCTGTTTATGCAAACATAGGC
GATGTGAAGAGCTTCCAGGCCGCGGAGGGGATCGAGGAACCCCTCTTGCATGACATCTGTTATGCAGAAAACACTGATGA
CGCGGAGGACGAGGACGAGGTGAGCTGCGAGGAGGACCTCGTGGTGGGGGAGATGAACCAGCCGGCCATCCTCAACCTGT
CTGGGTCAAGCGATGACATCATTGACCTCACATCCCTGCCCCCTCCAGAAGGTGATGACAATGAGGATGACTTCCTGTTG
CGTTCCTTGAACATGGCCATTGCCGCACCCCCACCTGGCTTTAGAGACAGTTCAGATGAAGAGGACTCTCAGAGCCAGGC
AGCTTCCTTCCCCGAGGACAAGGAGAAAGGCAGCAGCCTGCAAAATGATGAGATCCCCGTGTCCCTCATTGACGCTGTGC
CCACCAGCGCCGAAGGCAAGTGTGAGAAGGGACTGGATAATGCCGTCGTCTCCACGCTGGGAGCTCTAGAGGCTCTATCC
GTGTCAGAAGAACAGCAGACCAGTGACAATTCAGGTGTAGCCATCTTGCGGGCTTATAGTCCTGAGTCTTCGTCAGACTC
GGGCAATGAAACTAACTCTTCTGAAATGACTGAGAGTTCTGAACTGGCCACAGCACAAAAACAGTCAGAAAACCTCTCCC
GCATGTTCTTGGCCACTCACGAAGGCTACCACCCCCTTGCAGAAGAGCAGACCGAGTTCCCGGCCTCCAAGACCCCCGCT
GGGGGCTTGCCTCCAAAGTCCTCGCACGCCCTGGCTGCTAGGCCAGCAACCGACCTCCCGCCCAAAGTTGTGCCTTCCAA
GCAGTTACTTCACTCAGACCACATGGAGATGGAGCCTGAAACTATGGAGACTAAGTCGGTCACTGACTATTTTAGCAAAC
TGCACATGGGGTCGGTGGCATACTCCTGCACTAGCAAAAGGAAAAGCAAGCTGGCCGATGGTGAGGGGAAGGCACCCCCT
AATGGGAACACAACAGGAAAAAAACAGCAGGGGACCAAAACGGCAGAGATGGAGGAGGAGGCCAGTGGTAAATTTGGTAC
TGTGTCTTCACGAGACAGTCAACACCTGAGCACTTTTAATCTGGAGAGAACTGCCTTTCGCAAGGACAGTCAAAGATGGT
ATGTGGCCACTGAAGGTGGGATGGCTGAAAAAAGTGGATTAGAAGCAGCAACAGGGAAAACCTTTCCAAGAGCTTCTGGT
CTTGGGGCAAGGGAGGCCGAAGGGAAGGAAGAAGGAGCTCCTGATGGAGAAACCAGTGATGGCTCAGGACTTGGTCAAGG
GGACCGCTTCTTAACTGACGTGACCTGTGCATCTTCAGCCAAAGACTTAGATAACCCAGAGGACGCTGACTCGTCCACCT
GCGACCATCCTTCCAAGCTTCCTGAGGCTGATGAGAGTGTGGCCCGCCTTTGTGACTACCACTTGGCCAAGCGGATGTCA
TCACTGCAAAGCGAGGGCCATTTTTCTCTGCAGAGCTCCCAAGGCTCTTCAGTGGATGCAGGCTGTGGCACAGGCAGCAG
TGGCAGTGCCTGTGCCACACCCGTGGAGTCGCCGCTCTGCCCCTCCCTGGGGAAGCACTTGATTCCTGACGCTTCTGGGA
AAGGCGTGAATTACATTCCTTCAGAGGAGAGAGCCCCTGGGCTTCCCAACCACGGAGCCACCTTTAAGGAACTGCACCCA
CAGACAGAAGGGATGTGTCCACGGATGACAGTGCCTGCTCTGCACACAGCCATTAACACCGAACCCCTGTTTGGCACATT
GAGAGATGGATGCCATCGGCTCCCCAAGATTAAGGAAACCACAGTG

Protein (1322aa)

>JHU17147
MDVFSFVKIAKLSSHRTKSSGWPPPSGTWGLSQVPPYGWEMTANRDGRDYFINHMTQAIPFDDPRLESCQIIPPAPRKVE
MRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIVMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKS
AFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIK
GIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSCNDVVQER
FGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKL
SALQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLV
RVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGPENKGKHNLLGPDWNCIPQMTTF
IGEGEQEAQITYIDSKQKTVEITDSTMCPKEHRHLYIDNAYSSDGLNQQLSQPGEAPCEADYRSLAQRSLLTLSGPETLK
KAQESPRGAKVSFIFGDFALDDGISPPTLGYETLLDEGPEMLEKQRNLYIGSANDMKGLDLTPEAEGIQFVENSVYANIG
DVKSFQAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDIIDLTSLPPPEGDDNEDDFLL
RSLNMAIAAPPPGFRDSSDEEDSQSQAASFPEDKEKGSSLQNDEIPVSLIDAVPTSAEGKCEKGLDNAVVSTLGALEALS
VSEEQQTSDNSGVAILRAYSPESSSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPA
GGLPPKSSHALAARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTSKRKSKLADGEGKAPP
NGNTTGKKQQGTKTAEMEEEASGKFGTVSSRDSQHLSTFNLERTAFRKDSQRWYVATEGGMAEKSGLEAATGKTFPRASG
LGAREAEGKEEGAPDGETSDGSGLGQGDRFLTDVTCASSAKDLDNPEDADSSTCDHPSKLPEADESVARLCDYHLAKRMS
SLQSEGHFSLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIPSEERAPGLPNHGATFKELHP
QTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLPKIKETTV