Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17134 CPNE7 Homo sapiens No Membrane Proteins; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
6 26 13 JHU17134
6 26 14 JHU17134
HuProt v3.0
Block Row Column Clone
21 1 9 JHU17134
21 2 9 JHU17134
HuProt v3.1
Block Row Column Clone
21 1 9 JHU17134
21 2 9 JHU17134

External Database ID

Nucleotide (1674bp)

>JHU17134
ATGAGCGCGGGCTCGGAGCGCGGGGCGGCGGCAACCCCCGGGGGTTTGCCCGCGCCCTGCGCCTCGAAGGTGGAGCTGCG
GCTCAGCTGCCGGCACCTGCTGGACCGCGACCCGCTCACCAAGTCCGACCCCAGCGTGGCGTTGCTGCAGCAGGCGCAGG
GCCAGTGGGTGCAGGTGGGCAGAACCGAGGTGGTCCGGAGCAGCCTGCATCCCGTGTTCTCCAAGGTCTTCACGGTGGAC
TACTACTTCGAGGAGGTGCAGAGGCTGCGCTTTGAGGTGTACGACACGCATGGGCCCAGCGGCTTCAGCTGTCAGGAGGA
CGATTTCCTGGGGGGCATGGAGTGCACCCTGGGGCAGATTGTGGCCCAGAAGAAGGTGACCCGCCCGCTGCTGCTCAAGT
TTGGCAGGAACGCTGGCAAGTCCACCATCACGGTGATCGCCGAGGACATCTCGGGGAACAACGGCTACGTGGAGCTCTCC
TTCCGGGCCAGGAAGCTGGACGACAAGGACCTCTTCAGCAAGTCCGACCCCTTCCTGGAGCTCTACAGGGTCAACGACGA
CCAGGGCTTGCAGCTGGTGTACAGGACGGAGGTGGTGAAGAACAACCTGAACCCGGTGTGGGAGGCCTTCAAAGTCTCTC
TGAGTTCCCTCTGCAGCTGCGAGGAGACAAGGCCTCTAAAGTGCCTGGTCTGGGATTACGACTCTCGAGGAAAGCACGAC
TTCATCGGAGAATTCTCTACCACCTTCGAGGAGATGCAGAAGGCCTTTGAGGAGGGGCAGGCCCAGTGGGACTGTGTGAA
CCCCAAATACAAGCAGAAGAGACGCAGTTATAAGAACTCAGGAGTGGTCGTCCTGGCTGACCTCAAGTTCCACAGGGTGT
ACTCCTTCCTGGACTATATCATGGGCGGCTGCCAGATCCACTTCACCGTGGCCATTGACTTCACCGCCTCCAATGGAGAC
CCGCGGAACAGCTGCTCCCTGCACTACATCAACCCCTACCAGCCGAACGAGTACCTGAAGGCACTGGTGTCCGTGGGCGA
GATCTGCCAGGACTATGACAGTGACAAGAGGTTTTCCGCTTTGGGGTTTGGAGCCCGGATCCCTCCCAAGTATGAGGTGT
CCCATGACTTTGCCATCAATTTCAACCCTGAGGACGATGAGTGTGAAGGCATCCAGGGCGTGGTGGAGGCCTACCAGAAC
TGCCTGCCCAGGGTCCAGCTCTACGGCCCCACCAACGTGGCGCCCATCATCTCCAAGGTGGCACGCGTGGCGGCGGCCGA
GGAGAGCACCGGGAAAGCCTCTCAATACTACATCCTGCTGATCCTGACGGACGGCGTGGTGACCGACATGGCCGACACAC
GGGAGGCCATTGTGCGTGCCTCACGCCTGCCCATGTCCATCATCATCGTGGGCGTGGGCAACGCCGACTTCACCGACATG
CAGGTCCTGGACGGCGACGACGGCGTCCTGCGCTCCCCACGGGGTGAGCCCGCGCTCCGGGACATCGTACAGTTCGTGCC
CTTCCGGGAGCTCAAGAACGCATCCCCTGCGGCGCTGGCCAAGTGCGTGCTGGCCGAGGTCCCGAAGCAGGTGGTGGAGT
ACTACAGCCACAGAGGCCTGCCCCCGAGAAGCCTGGGCGTCCCTGCCGGAGAGGCCAGCCCAGGCTGCACACCG

Protein (558aa)

>JHU17134
MSAGSERGAAATPGGLPAPCASKVELRLSCRHLLDRDPLTKSDPSVALLQQAQGQWVQVGRTEVVRSSLHPVFSKVFTVD
YYFEEVQRLRFEVYDTHGPSGFSCQEDDFLGGMECTLGQIVAQKKVTRPLLLKFGRNAGKSTITVIAEDISGNNGYVELS
FRARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEAFKVSLSSLCSCEETRPLKCLVWDYDSRGKHD
FIGEFSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSFLDYIMGGCQIHFTVAIDFTASNGD
PRNSCSLHYINPYQPNEYLKALVSVGEICQDYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQN
CLPRVQLYGPTNVAPIISKVARVAAAEESTGKASQYYILLILTDGVVTDMADTREAIVRASRLPMSIIIVGVGNADFTDM
QVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP