Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17117 ARHGAP31 CDGAP;KIAA1204 Homo sapiens No Signal Transduction

HuProt v2.0
Block Row Column Clone
30 26 5 JHU17117
30 26 6 JHU17117
HuProt v3.0
Block Row Column Clone
23 1 27 JHU17117
23 2 27 JHU17117
HuProt v3.1
Block Row Column Clone
23 1 27 JHU17117
23 2 27 JHU17117

External Database ID

Nucleotide (4332bp)

>JHU17117
ATGAAGAACAAGGGTGCTAAGCAGAAGCTGAAACGAAAGGGAGCCGCCAGCGCGTTTGGCTGTGACCTGACGGAGTATCT
GGAAAGCTCGGGACAGGATGTTCCATACGTTTTGAAGAGCTGTGCAGAATTTATAGAGACTCACGGCATCGTGGATGGAA
TCTATCGGCTTTCAGGAGTCACCTCAAACATACAACGGCTAAGGCAAGAGTTTGGCTCAGATCAATGTCCAGATCTGACA
AGGGAAGTGTACCTCCAGGACATCCACTGTGTGGGCTCGCTTTGCAAGCTCTACTTTAGGGAGCTGCCCAACCCCCTCCT
GACTTATGAGCTCTATGAGAAATTCACGGAGGCAGTGTCGCATTGCCCTGAAGAAGGCCAACTGGCCCGAATCCAAAATG
TTATCCAGGAGCTTCCTCCATCCCACTATAGGACCTTGGAATACCTGATTCGACACCTGGCCCATATCGCCTCCTTCAGC
AGCAAGACCAACATGCACGCCCGGAACCTGGCCCTGGTGTGGGCGCCAAACCTCCTCAGGTCTAAAGAAATTGAAGCCAC
TGGTTGCAATGGAGATGCAGCCTTCCTTGCAGTCCGGGTCCAGCAGGTGGTGATTGAGTTCATATTGAATCATGTAGATC
AAATCTTTAACAACGGTGCACCTGGGTCTCTGGAGAATGATGAAAACCGGCCCATCATGAAGAGCCTGACCTTGCCAGCC
CTCTCCCTGCCCATGAAGCTGGTGAGCCTTGAGGAAGCTCAAGCCCGCAGCCTGGCCACTAACCATCCTGCTCGCAAGGA
AAGGAGGGAGAACAGCCTGCCTGAGATTGTCCCTCCCATGGGCACCCTCTTCCACACTGTCCTTGAGTTACCAGACAACA
AGCGAAAGCTCTCCAGTAAATCAAAGAAGTGGAAATCAATATTTAACCTGGGACGTTCTGGATCAGACTCCAAATCAAAA
CTGAGTAGAAATGGGAGTGTATTTGTGAGAGGACAGAGGCTCTCGGTGGAAAAGGCTACTATCCGACCAGCTAAAAGCAT
GGACTCACTATGTTCAGTGCCTGTGGAAGGAAAAGAAACCAAGGGAAATTTCAATCGAACAGTTACCACCGGTGGATTTT
TCATTCCAGCAACAAAGATGCACTCCACCGGCACCGGCAGCTCATGTGACCTCACCAAGCAGGAGGGCGAATGGGGCCAG
GAGGGGATGCCTCCCGGGGCTGAGGGTGGCTTTGATGTGAGCAGTGATCGCAGCCATCTCCAGGGCGCTCAGGCCCGGCC
CCCACCGGAACAGCTGAAGGTTTTCCGGCCTGTTGAGGATCCGGAGAGCGAGCAAACAGCCCCAAAGATGTTGGGTATGT
TCTACACTTCGAACGACAGCCCTAGCAAATCCGTCTTCACCAGCAGCCTCTTCCAGATGGAGCCCTCGCCGCGTAACCAG
CGCAAGGCGCTGAACATCTCCGAGCCCTTTGCGGTATCTGTGCCGCTCCGCGTGTCCGCAGTCATCAGCACCAACAGCAC
GCCGTGCAGAACACCCCCGAAGGAGCTGCAGTCTCTTTCCAGCCTGGAAGAGTTTTCTTTTCATGGATCAGAGAGCGGAG
GCTGGCCAGAAGAAGAGAAACCGCTGGGAGCTGAGACTTCTGCAGCTTCTGTACCTAAGAAGGCAGGTCTTGAGGATGCC
AAGGCAGTACCTGAAGCACCGGGGACAGTGGAATGCAGCAAAGGCCTGTCCCAGGAGCCAGGCGCCCACCTGGAGGAGAA
GAAAACCCCAGAAAGCTCCTTGAGCTCTCAACATTTAAATGAATTAGAGAAGAGGCCAAATCCGGAGAAGGTGGTGGAGG
AGGGACGAGAGGCTGGTGAGATGGAGTCCAGCACCCTGCAGGAGAGCCCCAGGGCCAGAGCCGAAGCTGTGCTTCTCCAT
GAGATGGATGAAGATGATCTGGCCAATGCCCTGATCTGGCCTGAGATTCAACAGGAGCTGAAAATCATTGAATCTGAGGA
GGAGCTCTCATCGTTGCCACCTCCTGCTCTGAAGACCAGCCCAATTCAGCCTATTCTCGAGTCGAGTCTGGGGCCCTTTA
TTCCCTCAGAGCCTCCTGGGAGCTTGCCTTGTGGCTCCTTCCCTGCTCCAGTCTCCACCCCTCTGGAGGTGTGGACTAGG
GATCCAGCCAATCAGAGCACACAGGGGGCTTCCACAGCAGCCAGCAGAGAGAAGCCGGAACCTGAGCAGGGCCTGCACCC
AGACCTCGCCAGCCTGGCTCCTCTGGAAATAGTTCCTTTTGAGAAGGCATCTCCACAAGCAACAGTGGAAGTAGGAGGCC
CAGGCAATCTGTCTCCTCCACTCCCACCTGCTCCTCCCCCTCCAACTCCTCTGGAGGAGTCAACTCCAGTCCTGCTTTCA
AAGGGCAGCCCGGAAAGAGAAGACTCATCCAGGAAATTGAGGACAGATCTCTACATAGACCAGCTGAAGTCCCAAGACAG
CCCTGAGATCTCTAGCCTCTGTCAGGGAGAGGAGGCAACCCCAAGACACAGTGACAAGCAAAATTCAAAGAATGCTGCTT
CTGAGGGGAAAGGCTGTGGTTTTCCAAGCCCAACCAGGGAGGTTGAGATCGTCTCACAAGAAGAGGAGGATGTAACCCAT
TCAGTACAGGAGCCTTCAGACTGTGACGAAGATGACACTGTGACAGACATTGCCCAGCATGGCCTGGAGATGGTGGAGCC
CTGGGAGGAACCCCAGTGGGTGACGAGTCCCCTTCACTCTCCCACCCTGAAAGACGCGCACAAGGCCCAGGTACAGGGCC
TTCAGGGTCACCAGTTGGAGAAGAGGCTTTCCCACAGGCCCAGCCTTCGCCAGAGCCATTCTCTAGATAGCAAACCCACG
GTTAAAAGCCAGTGGACTCTCGAGGTTCCCTCCTCCAGCAGCTGTGCTAATCTTGAAACAGAGAGGAATTCTGACCCTCT
TCAGCCCCAGGCACCCAGGAGAGAGATTACTGGATGGGATGAGAAAGCCCTGAGGTCCTTCAGAGAGTTCTCTGGCCTGA
AAGGGGCAGAGGCTCCTCCCAACCAGAAGGGACCAAGTGGTGTGCAACCCAACCCAGCAGAAACCAGCCCCATCAGCCTA
GCAGAGGGAAAGGAGCTAGGGACACACCTGGGGCACAGCAGTCCACAGATTAGGCAAGGTGGTGTTCCTGGGCCAGAGAG
CAGCAAGGAGAGTTCACCCAGCGTGCAGGACAGCACTTCGCCTGGAGAGCACCCCGCAAAGTTACAGCTAAAGAGCACAG
AGTGTGGGCCCCCAAAAGGGAAAAACAGGCCTTCTTCCCTCAACTTGGACCCTGCCATTCCCATTGCTGACCTCTTCTGG
TTTGAGAATGTGGCCTCATTTAGTTCACCTGGAATGCAGGTCTCTGAGCCAGGAGACCCAAAGGTCACATGGATGACCTC
ATCTTACTGTAAAGCAGACCCCTGGAGGGTTTACTCCCAGGACCCCCAGGACCTGGACATTGTTGCTCATGCACTGACAG
GCCGCCGTAACTCAGCTCCTGTGAGTGTGTCAGCTGTGAGAACCTCCTTCATGGTCAAAATGTGCCAGGCCAGGGCGGTC
CCAGTCATCCCTCCCAAGATTCAGTACACCCAGATCCCACAGCCCCTGCCCTCTCAGAGCTCAGGGGAGAATGGGGTTCA
GCCTCTGGAGAGGAGCCAGGAGGGACCCAGCTCAACCAGTGGGACCACTCAGAAACCTGCCAAAGATGATTCTCCCTCCT
CCCTGGAAAGCTCAAAGGAAGAAAAACCAAAGCAAGATCCCGGAGCCATTAAGTCCTCACCAGTGGATGCCACTGCACCC
TGCATGTGCGAGGGACCTACCCTTTCTCCAGAACCAGGCTCGTCTAACCTGCTCTCCACCCAGGATGCAGTAGTGCAATG
CAGAAAGCGCATGTCAGAGACAGAGCCATCTGGGGACAACCTTCTTTCTTCAAAACTAGAGCGACCATCTGGGGGTTCTA
AGCCTTTCCACAGGTCAAGGCCAGGAAGACCTCAGAGCCTAATCTTATTCAGTCCTCCTTTCCCCATTATGGACCACCTG
CCCCCTTCATCCACAGTGACAGATTCCAAGGTCCTGCTGTCCCCTATCAGAAGTCCCACCCAGACAGTTTCCCCTGGCCT
TCTTTGTGGAGAGTTGGCAGAAAACACATGGGTCACACCAGAAGGGGTTACACTTAGGAATAAAATGACCATCCCTAAGA
ATGGCCAGAGACTAGAGACCTCAACCAGCTGTTTTTACCAGCCTCAGCGGAGATCAGTAATTCTGGATGGAAGAAGTGGG
AGGCAAATAGAA

Protein (1444aa)

>JHU17117
MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGVTSNIQRLRQEFGSDQCPDLT
REVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVSHCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFS
SKTNMHARNLALVWAPNLLRSKEIEATGCNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGSLENDENRPIMKSLTLPA
LSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSSKSKKWKSIFNLGRSGSDSKSK
LSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKETKGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQ
EGMPPGAEGGFDVSSDRSHLQGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQ
RKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEKPLGAETSAASVPKKAGLEDA
KAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLNELEKRPNPEKVVEEGREAGEMESSTLQESPRARAEAVLLH
EMDEDDLANALIWPEIQQELKIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPGSLPCGSFPAPVSTPLEVWTR
DPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVEVGGPGNLSPPLPPAPPPPTPLEESTPVLLS
KGSPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEATPRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTH
SVQEPSDCDEDDTVTDIAQHGLEMVEPWEEPQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPT
VKSQWTLEVPSSSSCANLETERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPPNQKGPSGVQPNPAETSPISL
AEGKELGTHLGHSSPQIRQGGVPGPESSKESSPSVQDSTSPGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFW
FENVASFSSPGMQVSEPGDPKVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSFMVKMCQARAV
PVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKEEKPKQDPGAIKSSPVDATAP
CMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDNLLSSKLERPSGGSKPFHRSRPGRPQSLILFSPPFPIMDHL
PPSSTVTDSKVLLSPIRSPTQTVSPGLLCGELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSG
RQIE