Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17106 VHLL VLP Homo sapiens No

HuProt v2.0
Block Row Column Clone
12 26 5 JHU17106
12 26 6 JHU17106
HuProt v3.0
Block Row Column Clone
23 1 12 JHU17106
23 2 12 JHU17106
HuProt v3.1
Block Row Column Clone
23 1 12 JHU17106
23 2 12 JHU17106

External Database ID

Nucleotide (417bp)

>JHU17106
ATGCCCTGGAGAGCGGGGAACGGGGTGGGTTTAGAGGCCCAGGCGGGCACCCAGGAGGCAGGCCCAGAAGAGTACTGCCA
GGAAGAGTTGGGCGCCGAGGAGGAGATGGCAGCCAGAGCAGCATGGCCTGTGCTGCGCTCTGTGAACTCACGCGAGCTCT
CCCGGATCATCATCTGCAATCACAGCCCACGAATCGTGCTGCCTGTGTGGCTCAACTACTATGGCAAGCTGCTGCCCTAC
CTGACGCTGCTGCCCGGCAGGGACTTCCGCATCCACAACTTCCGAAGCCACCCTTGGCTCTTCAGAGATGCAAGGACACA
TGATAAGCTTCTGGTTAACCAAACTGAATTGTTTGTGCCATCTTCCAATGTTAATGGACAGCCTGTTTTTGCCAACATCA
CACTGCAGTGTATACCC

Protein (139aa)

>JHU17106
MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPY
LTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP