Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17102 KJ904213 Homo sapiens No Membrane Proteins

HuProt v2.0
Block Row Column Clone
26 26 13 JHU17102
26 26 14 JHU17102
HuProt v3.0
Block Row Column Clone
21 1 23 JHU17102
21 2 23 JHU17102
HuProt v3.1
Block Row Column Clone
21 1 23 JHU17102
21 2 23 JHU17102

External Database ID

Nucleotide (1716bp)

>JHU17102
ATGTGTCACTTCAAGCTGGTGGCCATAGTGGGCTACCTGATTCGTCTCTCAATCAAGTCCATCCAAATCGAAGCCGACAA
CTGTGTCACTGACTCCCTGACCATTTACGACTCCCTTTTGCCCATCCGGAGCAGCATCTTGTACAGAATTTGTGAACCCA
CAAGAACATTAATGTCATTTGTTTCTACAAATAATCTCATGTTGGTGACATTTAAGTCTCCTCATATACGGAGGCTCTCA
GGAATCCGGGCATATTTTGAGGTCATTCCAGAACAAAAGTGTGAAAACACAGTGTTGGTCAAAGACATCACTGGCTTTGA
AGGGAAAATTTCAAGCCCATATTACCCGAGCTACTATCCTCCAAAATGCAAGTGTACCTGGAAATTTCAGACTTCTCTAT
CAACTCTTGGCATAGCACTGAAATTCTATAACTATTCAATAACCAAGAAGAGTATGAAAGGCTGTGAGCATGGATGGTGG
GAAATTAATGAGCACATGTACTGTGGCTCCTACATGGATCATCAGACAATTTTTCGAGTGCCCAGCCCTCTGGTTCACAT
TCAGCTCCAGTGCAGTTCAAGGCTTTCAGACAAGCCACTTTTGGCAGAATATGGCAGTTACAACATCAGTCAACCCTGCC
CTGTTGGATCTTTTAGATGCTCCTCCGGTTTATGTGTCCCTCAGGCCCAGCGTTGTGATGGAGTAAATGACTGCTTTGAT
GAAAGTGATGAACTGTTTTGCGTGAGCCCTCAACCTGCCTGCAATACCAGCTCCTTCAGGCAGCATGGCCCTCTCATCTG
TGATGGCTTCAGGGACTGTGAGAATGGCCGGGATGAGCAAAACTGCACTCAAAGTATTCCATGCAACAACAGAACTTTTA
AGTGTGGCAATGATATTTGCTTTAGGAAACAAAATGCAAAATGTGATGGGACAGTGGATTGTCCAGATGGAAGTGATGAA
GAAGGCTGCACCTGCAGCAGGAGTTCCTCCGCCCTTCACCGCATCATCGGAGGCACAGACACCCTGGAGGGGGGTTGGCC
GTGGCAGGTCAGCCTCCACTTTGTTGGATCTGCCTACTGTGGTGCCTCAGTCATCTCCAGGGAGTGGCTTCTTTCTGCAG
CCCACTGTTTTCATGGAAACAGGCTGTCAGATCCCACACCATGGACTGCACACCTCGGGATGTATGTTCAGGGGAATGCC
AAGTTTGTCTCCCCGGTGAGAAGAATTGTGGTCCACGAGTACTATAACAGTCAGACTTTTGATTATGATATTGCTTTGCT
ACAGCTCAGTATTGCCTGGCCTGAGACCCTGAAACAGCTCATTCAGCCAATATGCATTCCTCCCACTGGTCAGAGAGTTC
GCAGTGGGGAGAAGTGCTGGGTAACTGGCTGGGGGCGAAGACACGAAGCAGATAATAAAGGCTCCCTCGTTCTGCAGCAA
GCGGAGGTAGAGCTCATTGATCAAACGCTCTGTGTTTCCACCTACGGGATCATCACTTCTCGGATGCTCTGTGCAGGCAT
AATGTCAGGCAAGAGAGATGCCTGCAAAGGAGATTCGGGTGGACCTTTATCTTGTCGAAGAAAAAGTGATGGAAAATGGA
TTTTGACTGGCATTGTTAGCTGGGGACATGGATGTGGACGACCAAACTTTCCTGGTGTTTACACAAGGGTGTCAAACTTT
GTTCCCTGGATTCATAAATATGTCCCTTCTCTTTTG

Protein (572aa)

>JHU17102
MCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTIYDSLLPIRSSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLS
GIRAYFEVIPEQKCENTVLVKDITGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGCEHGWW
EINEHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLAEYGSYNISQPCPVGSFRCSSGLCVPQAQRCDGVNDCFD
ESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDE
EGCTCSRSSSALHRIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNA
KFVSPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSLVLQQ
AEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNF
VPWIHKYVPSLL