Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17099 TEKT5 Homo sapiens No

HuProt v2.0
Block Row Column Clone
4 26 13 JHU17099
4 26 14 JHU17099
HuProt v3.0
Block Row Column Clone
21 1 2 JHU17099
21 2 2 JHU17099
HuProt v3.1
Block Row Column Clone
21 1 2 JHU17099
21 2 2 JHU17099

External Database ID

Nucleotide (1455bp)

>JHU17099
ATGGAGTTTCTTGGGACTACTCAGACCGCCAGTTACTGTGGTCCCAAGAAATGCTGTGGCTTGACCTCACTGCCAGCTGT
ACAGGCGCCAGTGATCCAGGAATGCTATCAGCCCTACTACCTGCCCGGGTACCGCTACCTCAATTCATGGAGGCCTAGCC
TCTTCTACAAGATAGCCAACGTCCAGACCTGCCCGGACGAGAGCACCAGTACCCTGCGGCCGCCCACCATCCTGCCCACA
CTGCGCTCCGCACTCTTCTCTCGCTATAGCCCCCACGACTGGGACCAGTCCAACCAGCTGCAGGTGCGTGGGGCCGAGGC
CTCCCGGCTGTGGGCCAGCCGGCTGACGGATGACTCCATGAGGCTCTTGCAGGACAAGGACCAGCTGACGCACCAGATGC
AGGAGGGCACCTGCCGGAACCTGGGCCAGAGGCTGTCGGACATTGGCTTCTGGAAGTCAGAGCTGAGCTATGAGCTGGAC
AGGCTTCTGACTGAGAACCAGAACTTGGAGACGGTCAAGAGGCGGCTGGAGTGCGCGGCCAATGAGGTGAACTGCCCATT
GCAGGTGGCCTTGGAGTGTCTGTACCATCGAGAGAAGAGGATTGGGATTGATTTGGTCCATGACAACGTGGAGAAAAACC
TTATCCGGGAAGTGGATTTGCTAAAATGTTGCCAAGAACAGATGAGAAAATTAGCTCAAAGAATTGATATCCAGATGCGG
GATAACCGGGATGCTCAGCACGTGCTGGAGAGGGACCTCGAAGACAAAAGCTCGGCCCAGTGTATCGATGAGAAGTGCTT
TAACCTGAGAAATACGTCAGACTGCATCAGCTTCTTCCACGGCATGGAGAAAATTGACGGCACGATCTCCGTACCTGAGA
CCTGGGCCAAGTTCAGTAACGACAACATCAAACACTCTCAGAACATGCGGGCCAACTCCATCCAGCTGCGGGAGGAGGCG
GAGCACCTCTTTGAGACCTTGTCGGATCAGATGTGGAGGCAGTTCACAGACACCAACCTGGCCTTCAACGCCCGCATCTC
TGAGGTGACGGATGTGAAGAATAAGCTGCAGACGCAGCTGGCGAAGACGCTGCAGGAGATCTTCCAGGCCGAGAACACCA
TCATGCTGCTGGAAAGGTCCATCATGGCCAAGGAGGGCCCGCTGAAGGTGGCCCAGACAAGGCTGGAGTGCCGGACCCGG
CGCCCCAACATGGAGCTGTGCAGGGACATCCCGCAGTTGAAGCTGGTGAACGAGGTGTTCACCATCGACGACACCCTGCA
GACCCTCAAGCTGCGGCTGCGGGAGACACAGGACACGCTGCAGCTGCTGGTCATGACCAAGTGCCGGCTGGAGCACGAGC
TCGCCATCAAGGCCAACACCCTCTGCATCGACAAGGAGAAGTGCATGGGCATGCGTAAGACCTTCCCCTGCACCCCGCGC
CTGGTGGGCCACACC

Protein (485aa)

>JHU17099
MEFLGTTQTASYCGPKKCCGLTSLPAVQAPVIQECYQPYYLPGYRYLNSWRPSLFYKIANVQTCPDESTSTLRPPTILPT
LRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELD
RLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMR
DNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEA
EHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTR
RPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFPCTPR
LVGHT