Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17084 PTH1R PTHR;PTHR1 Homo sapiens No Membrane Proteins

HuProt v2.0
Block Row Column Clone
18 26 13 JHU17084
18 26 14 JHU17084
HuProt v3.0
Block Row Column Clone
21 1 3 JHU17084
21 2 3 JHU17084
HuProt v3.1
Block Row Column Clone
21 1 3 JHU17084
21 2 3 JHU17084

External Database ID

Nucleotide (1779bp)

>JHU17084
ATGGGGACCGCCCGGATCGCACCCGGCCTGGCGCTCCTGCTCTGCTGCCCCGTGCTCAGCTCCGCGTACGCGCTGGTGGA
TGCAGATGACGTCATGACTAAAGAGGAACAGATCTTCCTGCTGCACCGTGCTCAGGCCCAGTGCGAAAAACGGCTCAAGG
AGGTCCTGCAGAGGCCAGCCAGCATAATGGAATCAGACAAGGGATGGACATCTGCGTCCACATCAGGGAAGCCCAGGAAA
GATAAGGCATCTGGGAAGCTCTACCCTGAGTCTGAGGAGGACAAGGAGGCACCCACTGGCAGCAGGTACCGAGGGCGCCC
CTGTCTGCCGGAATGGGACCACATCCTGTGCTGGCCGCTGGGGGCACCAGGTGAGGTGGTGGCTGTGCCCTGTCCGGACT
ACATTTATGACTTCAATCACAAAGGCCATGCCTACCGACGCTGTGACCGCAATGGCAGCTGGGAGCTGGTGCCTGGGCAC
AACAGGACGTGGGCCAACTACAGCGAGTGTGTCAAATTTCTCACCAATGAGACTCGTGAACGGGAGGTGTTTGACCGCCT
GGGCATGATTTACACCGTGGGCTACTCCGTGTCCCTGGCGTCCCTCACCGTAGCTGTGCTCATCCTGGCCTACTTTAGGC
GGCTGCACTGCACGCGCAACTACATCCACATGCACCTGTTCCTGTCCTTCATGCTGCGCGCCGTGAGCATCTTCGTCAAG
GACGCTGTGCTCTACTCTGGCGCCACGCTTGATGAGGCTGAGCGCCTCACCGAGGAGGAGCTGCGCGCCATCGCCCAGGC
GCCCCCGCCGCCTGCCACCGCCGCTGCCGGCTACGCGGGCTGCAGGGTGGCTGTGACCTTCTTCCTTTACTTCCTGGCCA
CCAACTACTACTGGATTCTGGTGGAGGGGCTGTACCTGCACAGCCTCATCTTCATGGCCTTCTTCTCAGAGAAGAAGTAC
CTGTGGGGCTTCACAGTCTTCGGCTGGGGTCTGCCCGCTGTCTTCGTGGCTGTGTGGGTCAGTGTCAGAGCTACCCTGGC
CAACACCGGGTGCTGGGACTTGAGCTCCGGGAACAAAAAGTGGATCATCCAGGTGCCCATCCTGGCCTCCATTGTGCTCA
ACTTCATCCTCTTCATCAATATCGTCCGGGTGCTCGCCACCAAGCTGCGGGAGACCAACGCCGGCCGGTGTGACACACGG
CAGCAGTACCGGAAGCTGCTCAAATCCACGCTGGTGCTCATGCCCCTCTTTGGCGTCCACTACATTGTCTTCATGGCCAC
ACCATACACCGAGGTCTCAGGGACGCTCTGGCAAGTCCAGATGCACTATGAGATGCTCTTCAACTCCTTCCAGGGATTTT
TTGTCGCAATCATATACTGTTTCTGCAACGGCGAGGTACAAGCTGAGATCAAGAAATCTTGGAGCCGCTGGACACTGGCA
CTGGACTTCAAGCGAAAGGCACGCAGCGGGAGCAGCAGCTATAGCTACGGCCCCATGGTGTCCCACACAAGTGTGACCAA
TGTCGGCCCCCGTGTGGGACTCGGCCTGCCCCTCAGCCCCCGCCTACTGCCCACTGCCACCACCAACGGCCACCCTCAGC
TGCCTGGCCATGCCAAGCCAGGGACCCCAGCCCTGGAGACCCTCGAGACCACACCACCTGCCATGGCTGCTCCCAAGGAC
GATGGGTTCCTCAACGGCTCCTGCTCAGGCCTGGACGAGGAGGCCTCTGGGCCTGAGCGGCCACCTGCCCTGCTACAGGA
AGAGTGGGAGACAGTCATG

Protein (593aa)

>JHU17084
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRK
DKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGH
NRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKY
LWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTR
QQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKD
DGFLNGSCSGLDEEASGPERPPALLQEEWETVM