Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17066 LIM2 Homo sapiens No

HuProt v2.0
Block Row Column Clone
2 26 5 JHU17066
2 26 6 JHU17066
HuProt v3.0
Block Row Column Clone
23 1 5 JHU17066
23 2 5 JHU17066
HuProt v3.1
Block Row Column Clone
23 1 5 JHU17066
23 2 5 JHU17066

External Database ID

Nucleotide (645bp)

>JHU17066
ATGTACAGCTTCATGGGTGGTGGCCTGTTCTGTGCCTGGGTGGGGACCATCCTCCTGGTGGTGGCCATGGCAACAGACCA
CTGGATGCAGTACCGGCTGTCAGGGTCCTTCGCCCACCAGGGCCTGTGGCGGTACTGCCTGGGCAACAAGTGCTACCTGC
AGACAGACAGCATCGGTGAGCCCCCCGGCCAGGGTCCAGGCCGCGCCTGGGGAAAGAGCAGGGCGGACCTCGGGGCCCAA
GGACACCTGTATTCCAGATGGAGAACTCTGCGGCTCAAAGAGGGAAAGGGAGCAACCCAAGCATACTGGAATGCCACCCG
GGCCTTCATGATCCTGTCTGCCCTATGCGCCATCTCCGGCATCATCATGGGCATCATGGCCTTCGCTCATCAGCCTACCT
TCTCCCGCATCTCCCGGCCCTTCTCTGCTGGCATCATGTTTTTTTCCTCAACCCTTTTCGTCGTGTTGGCCTTGGCCATC
TACACTGGAGTCACCGTCAGCTTCCTGGGCCGCCGCTTTGGGGACTGGCGCTTTTCCTGGTCCTACATCCTGGGCTGGGT
GGCAGTGCTCATGACGTTCTTCGCAGGGATTTTCTACATGTGCGCCTACCGGGTGCATGAATGCCGGCGCCTGTCTACAC
CCCGC

Protein (215aa)

>JHU17066
MYSFMGGGLFCAWVGTILLVVAMATDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQ
GHLYSRWRTLRLKEGKGATQAYWNATRAFMILSALCAISGIIMGIMAFAHQPTFSRISRPFSAGIMFFSSTLFVVLALAI
YTGVTVSFLGRRFGDWRFSWSYILGWVAVLMTFFAGIFYMCAYRVHECRRLSTPR