Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17062 KJ903784 Homo sapiens No

HuProt v2.0
Block Row Column Clone
10 26 13 JHU17062
10 26 14 JHU17062
HuProt v3.0
Block Row Column Clone
21 1 15 JHU17062
21 2 15 JHU17062
HuProt v3.1
Block Row Column Clone
21 1 15 JHU17062
21 2 15 JHU17062

External Database ID

Nucleotide (1866bp)

>JHU17062
ATGGTGGAGCTTCTGGACTTGTATCAGATGGAGGATGAAGCCTACAGCAGCCTTGCAGAAGCTACAACCGAACTCTATCA
GTATTTACTACAGCCATTCCGAGACATGAGAGAACTTGCCATGCTACGAAGACAGCAGATCAAGATTTCCATGGAGAATG
ATTATCTGGGACCTCGAAGAATTGAGAGTCTACAAAAAGAAGATGCTGATTGGCAGCGGAAAGCTCACATGGCTGTACTG
TCTATTCAAGATCTTACTGTCAAGTACTTTGAAATAACAGCTAAAGCTCAAAAAGCTGTGTATGATCGAATGCGAGCTGA
TCAGAAGAAATTTGGTAAAGCATCATGGGCAGCGGCTGCTGAACGGATGGAAAAACTCCAGTATGCAGTTTCTAAGGAAA
CTTTGCAGATGATGAGAGCTAAAGAGATATGCTTGGAACAGCGGAAACATGCACTAAAGGAAGAGATGCAGAGTTTGCGG
GGTGGTACAGAAGCGATAGCACGATTGGATCAGTTAGAAGCTGATTATTATGATCTGCAACTTCAGTTGTATGAAGTACA
GTTTGAAATCTTGAAGTGTGAAGAGTTACTATTGACAGCGCAACTAGAAAGCATCAAAAGACTTATATCAGAAAAAAGAG
ATGAAGTGGTATACTATGACACTTACGAAAGCATGGAGGCCATGCTGGAGAAGGAAGAGATGGCAGCATCTGCGTACTTA
CAGAGAGAAGAGCTGCAGAAACTTCAGCAGAAAGCACGCCAGCTGGAAGCAAGACGTGGACGGGTTTCTGCCAAGAAATC
CTACCTCAGAAATAAAAAGGAAATATGTATTGCAAAACACAATGAAAAAATCCAACAGCGCACTCGGATTGAAGATGAAT
ATAGAACCCATCACACAGTACAACTAAAGAGAGAAAAATTACATGATGAAGAAGAAAGAAAAAGTGCCTGGGTTAGCCAA
GAGAGACAGAGAACACTGGATAGACTTCGAACATTTAAACAGAGGTATCCTGGGCAAGTCATACTTAAATCAACCAGATT
ACGACTAGCTCATGCAAGAAGAAAAGGTGCAGCAAGTCCTGTTCTCCAAGAGGATCATTGTGACTCTTTACCAAGTGTGT
TACAGGTAGAAGAGAAAACTGAAGAGGTGGGAGAAGGAAGAGTCAAGCGTGGGCCATCACAGACAACAGAACCCCAGAGC
CTTGTGCAACTTGAAGATACTTCATTAACACAACTTGAAGCCACCTCATTACCTCTCAGTGGTGTTACCTCTGAACTGCC
TCCTACTATATCTCTTCCACTTTTGAATAACAACCTCGAACCATGTTCTGTTACCATAAATCCACTCCCATCCCCTCTTC
CTCCAACACCACCACCTCTGCCTGTTGCTAAGGACAGTGGCCCAGAGACACTGGAGAAAGATCTGCCTAGAAAGGAGGGG
AATGAGAAGAGGATCCCAAAGTCAGCCAGTGCCCCCTCAGCACACCTCTTTGACAGCAGCCAGCTGGTCAGTGCACGGAA
GAAGCTCAGAAAGACTGCTGAAGGTTTGCAGAGGAGGAGAGTGAGCTCACCCATGGATGAGGTGCTAGCCTCCTTGAAGC
GTGGTAGTTTTCATCTGAAAAAGGTTGAACAGCGAACTCTGCCTCCTTTTCCTGATGAAGATGATAGTAATAATATCTTG
GCACAAATAAGGAAAGGGGTAAAATTGAAGAAGGTACAGAAGGATGTTTTGAGAGAATCCTTCACACTTCTACCCGATAC
AGACCCTCTAACACGGAGCATCCATGAAGCTCTTAGAAGAATTAAAGAAGCATCCCCAGAGTCAGAGGACGAAGAGGAGG
CTTTACCTTGCACAGACTGGGAGAAC

Protein (622aa)

>JHU17062
MVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVL
SIQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQMMRAKEICLEQRKHALKEEMQSLR
GGTEAIARLDQLEADYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAMLEKEEMAASAYL
QREELQKLQQKARQLEARRGRVSAKKSYLRNKKEICIAKHNEKIQQRTRIEDEYRTHHTVQLKREKLHDEEERKSAWVSQ
ERQRTLDRLRTFKQRYPGQVILKSTRLRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQS
LVQLEDTSLTQLEATSLPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPLPVAKDSGPETLEKDLPRKEG
NEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNIL
AQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN