Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17059 IDO2 INDOL1 Homo sapiens No

HuProt v2.0
Block Row Column Clone
4 26 5 JHU17059
4 26 6 JHU17059
HuProt v3.0
Block Row Column Clone
23 1 2 JHU17059
23 2 2 JHU17059
HuProt v3.1
Block Row Column Clone
23 1 2 JHU17059
23 2 2 JHU17059

External Database ID
  • Reviewed UniProt: Q6ZQW0-2 (I23O2_HUMAN)

Nucleotide (516bp)

>JHU17059
ATGTTGCATTTTCATTATTATGATACTTCAAACAAAATAATGGAGCCCCACAGACCGAATGTGAAGACAGCAGTGCCATT
GTCTTTGGAAAGCTATCACATATCTGAAGAGTATGGCTTTCTTCTTCCAGATTCTCTGAAAGAACTTCCAGATCATTATA
GGCCTTGGATGGAAATTGCCAACAAACTTCCTCAATTGATTGATGCTCACCAGCTTCAAGCTCATGTGGACAAGATGCCC
CTGCTGAGCTGCCAGTTCCTGAAGGGTCACCGGGAGCAGCGCCTGGCCCACCTGGTCCTGAGCTTCCTCACCATGGGTTA
TGTCTGGCAGGAAGGAGAGGCGCAGCCTGCAGAGGTCCTGCCAAGGAATCTTGCCCTTCCATTTGTCGAAGTCTCCAGGA
ACTTGGGGCTCCCTCCTATCCTGGTCCACTCAGACTTGGTGCTGACGAACTGGACCAAAAAAGATCCAGACGGAGACGGA
GTCTCCCTCTGTCTCCCAGGCTGGAGTGCAGTGGCA

Protein (172aa)

>JHU17059
MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMP
LLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGDG
VSLCLPGWSAVA