Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17053 GADD45B MYD118 Homo sapiens No Cell Death; Kinases

HuProt v2.0
Block Row Column Clone
20 26 5 JHU17053
20 26 6 JHU17053
HuProt v3.0
Block Row Column Clone
23 1 20 JHU17053
23 2 20 JHU17053
HuProt v3.1
Block Row Column Clone
23 1 20 JHU17053
23 2 20 JHU17053

External Database ID

Nucleotide (480bp)

>JHU17053
ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGGAGGAGCTTTT
GGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGATGAATGTGGACCCAGACAGCG
TGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCCCTGCAAATCCACTTCACGCTCATCCAGTCC
TTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGGGCATGCAGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGA
GACCCAGGGCACCACCGAGGCCCGAGACCTGCATTGTCTCCTGGTCACGAACCCTCACACGGACGCCTGGAAGAGCCACG
GCTTGGTGGAGGTGGCCAGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGC

Protein (160aa)

>JHU17053
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQS
FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER