Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17049 YK033 Homo sapiens No

HuProt v2.0
Block Row Column Clone
28 26 5 JHU17049
28 26 6 JHU17049
HuProt v3.0
Block Row Column Clone
23 1 26 JHU17049
23 2 26 JHU17049
HuProt v3.1
Block Row Column Clone
23 1 26 JHU17049
23 2 26 JHU17049

External Database ID
  • Reviewed UniProt: A1L4Q6 (YK033_HUMAN)

Nucleotide (501bp)

>JHU17049
ATGGCAGCTCTTTCTTCTCGGTGCCCTCGCAGTGCAGCAGGCCCCGCTTATTTGCAAGAAGCAGCCAGGTCAGCCCACTG
GGCCTCCCCACCTCTTGTGCCCCTTCGCACATTTCAGAGCTCTCTCTTTTCCTCTGGGTCCTTCCATTCAAGAGAGGAGG
AGGAGGAGGGGGTGAGCCTGTTGCGAACGGCGTTGGTGGGGCAGGGGCCGGTTCCCCTGTTTCTGGGGAGCCTTTTCTGT
GCTGGTTGCAGGCAGGGGCCCTCAGTGTGGAGCTGTGGTGAGCCTGTGCCCCGTCGTATTTGGGTCACAGCCTCCGTGAC
CCCTAGCCCCCGCCAGGCACTCCACCCCTGCAGTGATTCGCTTGATATTTTAAAAGCACTCCATCTTCTGCCTGCTGCCT
TCTCTCCATTCATCTGGGTCCAGGTTTTCGCCGAGCCATCTAATAAAGAATCCAGGGGGGAGAATGATGGGGGCGAGGAG
AGGGAAAGTGCTAACATTTAT

Protein (167aa)

>JHU17049
MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFC
AGCRQGPSVWSCGEPVPRRIWVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEE
RESANIY