Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17042 DMRTA1 DMO Homo sapiens No Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
12 26 13 JHU17042
12 26 14 JHU17042
20 26 13 JHU17042
20 26 14 JHU17042
HuProt v3.0
Block Row Column Clone
21 1 12 JHU17042
21 2 12 JHU17042
21 1 20 JHU17042
21 2 20 JHU17042
HuProt v3.1
Block Row Column Clone
21 1 12 JHU17042
21 2 12 JHU17042
21 1 20 JHU17042
21 2 20 JHU17042

External Database ID

Nucleotide (1512bp)

>JHU17042
ATGGAGCGGTCACAGTGTGGCAGCAGAGACCGAGGCGTTAGCGGCCGACCTCACTTGGCCCCTGGGCTAGTGGTGGCTGC
CCCTCCGCCCCCGTCCCCGGCGTTGCCGGTACCATCGGGGATGCAGGTTCCCCCAGCGTTCCTGCGGCCGCCCAGCCTCT
TTCTGCGAGCAGCGGCCGCGGCCGCCGCCGCCGCTGCCGCCACCTCGGGAAGCGGAGGCTGCCCGCCGGCTCCCGGGCTG
GAGAGCGGGGTAGGCGCGGTGGGCTGCGGCTACCCGCGGACGCCCAAGTGCGCCCGCTGTCGTAACCATGGTGTGGTGTC
AGCGCTCAAGGGCCACAAGCGCTTCTGCCGCTGGCGGGACTGCGCGTGTGCCAAGTGCACCCTGATCGCCGAGCGCCAGC
GCGTCATGGCCGCCCAGGTGGCGCTGCGCAGGCAGCAGGCGCAGGAGGAGAGCGAAGCCCGGGGGCTACAGAGGCTCCTG
TGCTCGGGGCTCTCCTGGCCCCCCGGTGGTCGGGCATCCGGGGGCGGCGGCAGAGCCGAGAATCCACAGTCCACGGGCGG
CCCTGCGGCGGGGGCTGCGCTGGGACTGGGAGCCTTGAGACAGGCCAGTGGTTCCGCGACCCCCGCTTTCGAAGTTTTCC
AGCAAGATTATCCTGAGGAAAAACAAGAACAAAAAGAGAGTAAATGTGAGTCATGCCAGAATGGACAAGAAGAACTGATC
TCCAAATCCCATCAGCTTTACCTAGGATCATCTTCTAGGTCTAATGGTGTCATTGGGAAACAAAGTATCGGGTCATCTAT
TTCAGAATACTCCAACAAGCCTGATAGTATCCTGTCTCCTCATCCTGGAGAGCAATCAGGAGGTGAAGAGAGTCCCAGGT
CCTTATCATCCTCTGATCTGGAATCAGGAAATGAAAGTGAATGGGTCAAAGACTTGACTGCGACCAAGGCAAGCCTTCCG
ACAGTGTCCTCAAGACCAAGAGATCCTCTTGATATCCTTACTAAGATTTTCCCAAATTACAGGCGCAGCCGGCTAGAAGG
CATTCTACGGTTCTGCAAAGGGGATGTGGTCCAAGCCATTGAACAGGTTTTAAATGGCAAAGAACACAAGCCAGACAACA
GGAACCTAGCAAACTCAGAAGAACTGGAAAACACAGCCTTTCAGAGAGCTTCAAGTTTTAGTCTTGCTGGAATTGGTTTT
GGAACTCTAGGTAATAAATCAGCTTTCTCTCCTCTTCAAACTACTTCTGCTTCTTATGGAGGTGATTCAAGTCTCTACGG
CGTAAATCCTAGAGTAGGTATCAGTCCATTAAGGCTGGCATATTCTTCTGCAGGAAGAGGGTTATCTGGTTTTATGTCAC
CCTACCTAACACCTGGGTTAGTACCAACCTTACCTTTTCGGCCAGCTTTGGATTATGCCTTTTCAGGGATGATTAGAGAT
TCTTCCTACCTTTCCAGTAAAGACTCAATAACTTGTGGCAGACTGTACTTCAGACCAAATCAGGACAATCCG

Protein (504aa)

>JHU17042
MERSQCGSRDRGVSGRPHLAPGLVVAAPPPPSPALPVPSGMQVPPAFLRPPSLFLRAAAAAAAAAAATSGSGGCPPAPGL
ESGVGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLQRLL
CSGLSWPPGGRASGGGGRAENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELI
SKSHQLYLGSSSRSNGVIGKQSIGSSISEYSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLP
TVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRASSFSLAGIGF
GTLGNKSAFSPLQTTSASYGGDSSLYGVNPRVGISPLRLAYSSAGRGLSGFMSPYLTPGLVPTLPFRPALDYAFSGMIRD
SSYLSSKDSITCGRLYFRPNQDNP